KEGG   Corynebacterium diphtheriae 241: CD241_1574Help
Entry
CD241_1574        CDS       T01687                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide acetyltransferase (EC:2.3.1.12)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD241_1574 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CD241_1574 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CD241_1574 (sucB)
Enzymes [BR:cdp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CD241_1574 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1658258..1659871
Genome map
AA seq 537 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDAVTADEPLLEVSTDKVDTEVPSPVSGVLLEIK
FEEDDTVDVGDVIAIIGEEGDAPAAKEEPAEEPKAEAPKAEAADSTDVVMPELGESVTEG
TITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVIVRVG
TPGSAPAAKEEPAKEPKAETPKEEPKAEAPKAEPKKEAPAKTINNENVPYVTPLVRKLAD
KHGVDLTTVEGTGIGGRIRKQDVLAAAGVGAAPAAQVAPAQPVSAASTKSVDPEKQKLIG
TTQKVNRIREITARKTVEALQISAQLTQLHEVDMTKVAELRKANKPAFQEKHGVNLTYLP
FFAKAIVEALVAHPNVNASYNAETKEMTYHADVNLSIAVDTPAGLLTPVIHKAQELSLPE
LAKAIVDLADRARNNKLKPNDLSGGTFTITNIGSEGALSDTPILVPPQAGILGTGAIVKR
PVVITEDGIDSIAIRQMVYLPLSYDHQIVDGADAGRFLTTIKDRLETANFEGDLELS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgtaatgcctgaactgggcgaatccgtcaccgaaggtaccatcacc
cagtggctgaagtccgttggtgacgcggtcactgccgacgagccgttgctcgaggtatct
actgacaaggtcgacactgaagttccttcgcctgtctccggtgtcttgcttgagatcaag
tttgaggaagatgacaccgtagacgtcggagacgttattgcgattattggcgaagaaggc
gacgctccagctgccaaggaagagccagcagaggagccaaaagctgaggcaccaaaggct
gaagcagctgactccaccgacgtagtcatgcctgaactcggcgagtccgtcaccgaaggc
accatcacccagtggctgaagtccgttggcgacaccgtcgacgttgacgaaccactcctc
gaagtctccaccgacaaggtcgacaccgaagtcccatccccagtcgctggcaccatcctc
gaaatcctcttcaacgaagacgacaccgtcgacgtcggagacgtaatcgttcgcgttggc
accccaggatctgctccagcagccaaggaagagccagccaaggagccaaaagccgagaca
ccaaaggaagagccaaaagctgaggcaccaaaggctgagccaaagaaggaagctcctgcc
aagaccatcaacaacgagaacgtcccttacgtcactccgctggtccgcaagctggctgac
aagcacggcgttgatctgaccactgttgaaggcactggtattggtggacgcatccgcaaa
caggatgttttggctgctgctggcgttggcgcagcccctgcagcacaggttgctcctgcc
cagccagtttctgcagcatccaccaagtccgtggatccagagaagcagaagctgatcggt
acaactcagaaggtcaaccgtatccgagagatcaccgcgcgcaagactgtggaggctttg
cagatttctgctcagctcacccagctgcatgaggtcgatatgactaaggttgcggaactg
cgtaaggccaacaagccagccttccaagaaaagcacggtgtgaacctcacctacttgcca
ttctttgcaaaggcaattgttgaggctttggttgctcacccgaacgtcaatgcgtcctac
aacgctgagacaaaggagatgacctaccacgctgatgtcaacctctccatcgccgttgac
accccagctggtctgcttacccctgttatccacaaggctcaggagttgtccttgcctgag
ctcgctaaggcaattgtcgatttggctgaccgtgctcgtaacaacaagctcaagccgaat
gatctttccggtggcaccttcaccattaccaacattggttctgagggcgctctcagcgat
accccaatcttggttccaccacaggcaggtatcttgggtaccggcgctattgttaagcgt
ccagtagtcatcacggaagatggcatcgattcgattgctattcgccagatggtctacttg
ccacttagctacgatcaccagatcgtcgatggtgccgatgcaggtcgtttcttgaccacc
atcaaggatcgccttgagactgcaaacttcgaaggcgacctcgaactctcctag

DBGET integrated database retrieval system