KEGG   Corynebacterium diphtheriae 241: CD241_1600Help
Entry
CD241_1600        CDS       T01687                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
cdp00260  Glycine, serine and threonine metabolism
cdp00750  Vitamin B6 metabolism
cdp01100  Metabolic pathways
cdp01110  Biosynthesis of secondary metabolites
cdp01120  Microbial metabolism in diverse environments
cdp01230  Biosynthesis of amino acids
Module
cdp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD241_1600 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CD241_1600 (thrC)
Enzymes [BR:cdp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CD241_1600 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP PLCC
Motif
Other DBs
NCBI-ProteinID: AEX44657
Position
complement(1686099..1687547)
Genome map
AA seq 482 aa AA seqDB search
MKYISTRDASSTPARFTDILLGGLAPDGGLYLPEQYPQLTEELLEQWRTLLEDKGYAALA
AEVLKLFIDDIPAADIEKITARAYTTPKFSDEDIVPVTKLENNIYIGHLSEGPTAAFKDM
AMQLLGELFEYELGRRGESLNILGATSGDTGSSAEYAMRGRKGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDVVKAVSGDSEFKKNYRIGAVNSINWARLVAQVVYY
ISSWLRVTDSNDQKVSFCVPTGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFRTG
DYRVRSSADTYETSSPSMDISRASNFERFVFDLLGRDAGRVADLFGVQVKQGGFSLAQDP
AFAEAANRYGFASGKSTHADRVATIADCYENRGMMIDPHTADGVKVARDWACDIDSPIVC
LETALPVKFADTICEATGREPEMPERFANIMDAQRRVTDLPNDVSVVKDFIVTSIEETEK
TQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatttcaacgcgcgacgcatcatcaacacctgctcgttttaccgatatcttg
cttggtggacttgcccccgatggtggcctgtacctgccagaacagtatccacaactgacc
gaagagctgcttgagcagtggcgtacgttgttagaagataaagggtatgcggcactcgct
gctgaagtattaaagctatttatcgacgacatccccgcggccgatattgaaaaaatcacc
gcccgtgcgtacaccacgcccaagttttctgatgaagacatcgttccagtgacaaaactg
gagaacaacatttatatcggtcatctttcagaaggcccaacggcggcatttaaagacatg
gcaatgcagttgctcggcgaacttttcgaatatgagctagggcgtcgcggcgaatccctg
aatatcctcggtgcaacctccggtgacaccggatcgtctgcggaatacgccatgcgtggc
cgaaaggggatccgcgtttttatgctcacccctgcgggacgtatgaccccattccaacag
gcacagatgttcggtcttgatgacccaaatatctttaatatcgcgctcgatggtgtattc
gacgattgccaagatgtagttaaagcagtgtcgggggattcggaatttaaaaagaactac
cgaatcggagcggtgaactccattaactgggcacgtcttgtagcacaagttgtgtattac
atttcttcttggcttcgcgttaccgatagcaacgatcaaaaagtgagcttttgtgtacca
accggcaacttcggtgacatctgcgcagggcatattgcaaaacagatgggtcttcctatc
gatcgccttatcgttgcaacgaatgaaaatgatgtgctcgatgagtttttccgcaccggc
gattaccgtgtacgcagctctgcagatacgtatgaaacgtcttctccgtccatggacatt
tcgcgtgcttctaactttgaacgctttgtatttgatcttctcggacgagatgcaggcaga
gtagctgatctatttggtgtacaagtcaagcagggtggattcagcttggctcaggaccca
gcattcgccgaggccgcgaatcgttacggatttgcctccggtaaatctacccatgctgat
cgcgttgccacgattgcagactgctacgaaaatcgtggcatgatgatcgaccctcatacc
gcggacggtgtgaaagtagcacgagattgggcctgcgatattgattcgccaattgtctgc
cttgaaactgcgcttccagttaagttcgctgacactatctgcgaagcaacaggacgcgaa
cctgagatgccagagcgctttgccaacatcatggatgctcaacgtcgtgtaactgatctt
cctaatgacgtatcagtggtcaaagacttcattgtgactagcatcgaggaaaccgaaaaa
actcagtag

DBGET integrated database retrieval system