KEGG   Corynebacterium diphtheriae 241: CD241_1658Help
Entry
CD241_1658        CDS       T01687                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CD241_1658 (malQ)
Enzymes [BR:cdp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CD241_1658 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1750604..1752772
Genome map
AA seq 722 aa AA seqDB search
MSYSDLLRELAAAHAISSSYSGFGGAHVEVSDDTLVKTLRSLGVCFGNEDEPATDHEPLT
GPMPSEDQIRYALQQRYDAEATRPLPRCVVAVESDPYVFNVHVHDGAPADITITLEDGST
AEVTQVENWTPPREVDGITWGEASFQLPSDLPLGWHTITLTSDTLTSSCFLIVTPARLST
ADKYAEHPVSGVMAQLYSARSKNSWGMGDFNDLGLLAETLAPQADYLLINPLHAAEPMPP
VEDSPYLPTTRRFINPIYIRIEDIPEHLLLDDDLQNDVTELAEEFTALNLTPKKIERNPI
FDAKLQVLHAVFNVEREPAREQDFQDFIATEGQGLRDFASWCAEQELAVLENSAAHAALP
EKESLIQFYMWQQWICDQQLGAAQTRATDAGMSIGIIADLAVGIHPAGADALSLADTLVA
RASVGAPPDSYNHQGQDWSQPPWHPDRLAESGYIPWRDLLRTVLRHAGGVRVDHILGLFR
LFWIPRTQSPQTGTYVNYDHNALVGVLALEAERAGAVVIGEDLGTFEPWVQDFLASRGIM
GTSVLWFESSPEGGPRKQHEYRQLALTSVTTHDLPPTAGYLAGEHIALREELGILTTDVA
TEYAEDLNWQADILNVVRNSGAFDSIVPADFHGVDRADRGSSVELLSALHRFLAGTPSAL
ACTALVDLVADKRAQNQPGTTSDQYPNWCIPLCDESGTPVLIEDLAENPVYQAVTKASTR
LH
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtgagttactcagatttgttacgcgagctggccgctgcccacgcaatctcttcgtcgtac
tccggtttcggtggagcacacgtggaagtttcggatgacacgctggtcaagactctgcga
tccctcggagtttgcttcggaaatgaagacgaacccgccaccgaccacgagcctttgact
gggcctatgcctagcgaggatcaaatccgctacgccctacaacagcgttacgacgccgaa
gcaacccgccccctcccccgatgtgtggttgccgtcgaaagcgatccctatgtgttcaac
gtccatgttcacgacggtgctcccgccgacatcaccatcactttggaagatggttcaacc
gcagaggttacccaggttgaaaactggactccaccccgtgaagttgatggcattacttgg
ggtgaagcttccttccagctgccgtccgatcttccactgggctggcacaccatcaccttg
acctccgacacgctaacgtcaagctgcttcctcatcgtgaccccggcgcgtctatctacc
gccgacaagtatgcagagcaccctgtcagcggtgttatggcgcagctgtactcggctcgc
agcaagaattcttggggcatgggtgacttcaatgacctcggcttgttggctgagacgctt
gctcctcaggctgattatctgttgattaatcctctgcacgctgctgagccgatgccacca
gttgaggattccccatacttgcctactacgcggcgttttatcaacccaatttatatccgc
atcgaagatatccctgaacacttgcttctcgacgatgacctacaaaatgatgtcaccgaa
cttgcggaagagttcacagcacttaatctcacccctaaaaagattgagcgcaatccaatt
tttgatgccaagttgcaagttctgcacgcggtattcaatgtagagcgcgaaccagcacgt
gaacaggacttccaagacttcatcgccaccgaaggccaaggcctacgagacttcgcttca
tggtgcgcagagcaggagctagcagttttggagaactccgcagcacatgccgctcttccg
gaaaaagaatctcttatccagttctacatgtggcagcagtggatttgcgatcaacagctt
ggtgctgctcaaacccgcgcaaccgacgctggaatgagcatcggtatcatcgccgatctc
gccgtgggcattcaccctgcgggtgccgatgcactttcgcttgccgacaccctagtcgcc
cgcgcttctgtgggtgcgccaccagatagctacaaccaccaaggccaagactggtctcag
ccaccatggcacccagaccgcttggctgagtcgggctatatcccttggcgtgacctgctg
cgcacggtgcttcgccacgccggtggtgtccgtgttgaccacattcttggtcttttccgc
ttgttctggattcctcgcacccagtccccacaaacgggtacttacgtcaactacgatcac
aatgcacttgtgggcgtacttgctcttgaggcagagcgtgcaggcgcagtggttatcggt
gaagacctcggtaccttcgagccatgggtccaagacttccttgcgtcccgaggtatcatg
ggtacttcagtgctgtggttcgaaagttccccagaaggtggccctcgcaagcagcacgag
taccgtcagttggcgctgacctcggtaaccacccatgatctgccaccaacagcgggctat
ctggcaggcgagcacattgcgttgcgtgaggaactcggaattttgaccaccgatgtagca
actgagtatgccgaggatttgaactggcaggcagacatcctcaatgtagttcgcaactcg
ggcgcatttgactccatcgtccctgccgatttccacggtgtagatcgtgctgaccgcggc
agctccgtcgaattgctttccgcgcttcaccgcttcttggctggtacaccatcagctctg
gcctgcaccgctttggtggatcttgtcgccgataagcgtgcgcagaaccagccgggtact
acttcggatcagtacccgaactggtgtattccgctatgcgacgagtccggcactccagtc
cttatcgaggacttggccgaaaaccccgtctatcaagcggtaacaaaggcgtcgactcgc
ctacattag

DBGET integrated database retrieval system