KEGG   Corynebacterium diphtheriae 241: CD241_1845Help
Entry
CD241_1845        CDS       T01687                                 

Gene name
purD
Definition
(GenBank) phosphoribosylamine-glycine ligase
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
cdp00230  Purine metabolism
cdp01100  Metabolic pathways
cdp01110  Biosynthesis of secondary metabolites
cdp01130  Biosynthesis of antibiotics
Module
cdp_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CD241_1845 (purD)
Enzymes [BR:cdp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     CD241_1845 (purD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GARS_A GARS_N GARS_C ATP-grasp_3 CPSase_L_D2 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AEX44900
Position
complement(1954627..1955913)
Genome map
AA seq 428 aa AA seqDB search
MRILVIGSGAREHALVLGLSKDPSVSEIHVAPGNAGMEQIATVHADATSVDDPAQMLQVA
QDVQADLVVVGPEIPLVAGVADVLRQNGFAVFGPNKDAARIEGSKAFAKDVMEKAGVRTA
RAEQILPEASDEQRDAALDRFGPHYVVKDDGLAGGKGVVVTDDREVARAHVDAVLAAGNP
VLLESFLDGPEVSLFCLVDGETVVPLIPAQDHKRAYDNDEGPNTGGMGAYTPLPWLPEDG
VQRIVDEVCVPVAREMVRRGCSYSGLLYAGLAWGAEGPSVVEFNCRFGDPETQAVLALLR
TPLAQVLQSVAEGTLAQAPALEWQDGYALTVVLAAEGYPEIPRKGGVITGADVADASGTT
AVLHAGTARDEQGNVVANGGRVLNVVGTGATLADARDNAYRVLEGIKLEGSHFRSDIALP
AVEGRISI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattcttgttatcggttcgggcgcccgtgagcacgccctcgtactaggtttgtcc
aaggatccatctgtttctgagatccatgttgccccaggcaacgcaggcatggaacagatc
gcaacggttcatgctgatgccacttccgtggatgacccagcacagatgctgcaggtcgcg
caggatgttcaggctgatttggttgtggtcggccctgaaattccgctggtagcaggtgtg
gctgatgttcttcgtcagaacggtttcgcggtgttcggcccgaataaggatgctgctcgc
atcgagggctcgaaggcttttgccaaagatgtgatggaaaaagctggtgtgcgtacggct
cgtgcggagcagattcttcctgaggcaagcgatgagcaacgcgatgcggctttggatcgt
tttggcccgcattatgtggtcaaggatgatggccttgctggtggcaagggtgttgttgtt
actgatgatcgtgaggttgcgcgtgcgcatgtcgacgcggtgctcgctgcgggtaatccg
gtgctgttggagagcttcttggatggccctgaggtgtccttgttctgcttggttgatggc
gagactgtcgttcctttgatccctgcgcaggatcacaagcgtgcttacgataatgatgag
gggccgaacacgggtggtatgggcgcttatacgccgttgccgtggcttcctgaagatgga
gtacagcgcattgtcgacgaagtctgtgtgcctgtggctcgtgagatggtgcgtcgtggt
tgctcgtattctggtttgttgtatgcaggcttggcgtggggtgctgagggcccctctgtg
gtggaatttaactgccgttttggtgatccagaaactcaggcggtgttggcgttgctgcgt
accccgttggctcaggtgctgcagtcggtggctgagggtacgttggcgcaggccccagcg
ttggagtggcaggatggctacgctttgactgttgttttggctgctgaggggtacccagaa
atcccgcgtaagggtggcgtgatcacgggtgctgatgtggctgatgcctcgggtaccacg
gctgtgttgcatgctggtactgcacgtgatgagcagggcaacgtggtggccaatggtggc
cgtgtgcttaacgtggtgggtacgggggcaacgcttgccgacgcccgcgacaacgcctac
cgcgtgttggaagggatcaagctggagggttcgcatttccgctctgatattgcgcttccg
gcagttgagggtcgtatttcgatttaa

DBGET integrated database retrieval system