KEGG   Corynebacterium diphtheriae HC03: CDHC03_0193Help
Entry
CDHC03_0193       CDS       T01695                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cdr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187430..188086
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDEFSRLPGVGPKSAQRIAFHLLHVEPADITRLQDALGAIRDGVTFCRICC
NISREEVCRICADSSRDRSTICVVEEPKDIQVIERTGEYTGRYHVLGGSLDPLANIGPRE
LNISQLLQRIGGVLPDRELADSTPEAPLYDASPEVREVILATDPNTEGEATASYLARLLR
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggacctctccaagacctgattgacgagttttctcggctccctggtgtgggg
ccgaagtcggctcagcgcattgctttccacctgctccatgtggaaccagcagacattacg
cgtctgcaagatgcgctgggtgctattcgtgacggtgttactttctgccgcatttgctgc
aatatctctcgcgaagaggtctgccgcatttgtgcggactcttcacgcgaccgtagcacc
atctgtgtggtggaagaacctaaagacattcaggttattgaacgaaccggcgagtacaca
ggtcgctaccatgtgctcggtggctcgcttgacccccttgccaacattggcccccgtgag
ctcaacatttcgcaattgttgcagcgtatcggcggcgtgttgccagaccgtgagcttgct
gactccacccccgaggcaccgctttacgacgcctccccagaagtgcgcgaggttatcctc
gccaccgaccccaacaccgaaggcgaagccacagcctcctacctagcgcggctgctgcgc
gacttcccagaccttgtggtgtcacgccttgcctccggcatgccactcggcggtgacctg
gagttcgttgacgaactcaccttgtcgcgtgcgctaagtgggcgtcttacgctttaa

DBGET integrated database retrieval system