KEGG   Corynebacterium diphtheriae HC03: CDHC03_0318Help
Entry
CDHC03_0318       CDS       T01695                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
cdr00010  Glycolysis / Gluconeogenesis
cdr00260  Glycine, serine and threonine metabolism
cdr00680  Methane metabolism
cdr01100  Metabolic pathways
cdr01110  Biosynthesis of secondary metabolites
cdr01120  Microbial metabolism in diverse environments
cdr01130  Biosynthesis of antibiotics
cdr01200  Carbon metabolism
cdr01230  Biosynthesis of amino acids
Module
cdr_M00002  Glycolysis, core module involving three-carbon compounds
cdr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC03_0318 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CDHC03_0318 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDHC03_0318 (gpmA)
Enzymes [BR:cdr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CDHC03_0318 (gpmA)
Membrane trafficking [BR:cdr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CDHC03_0318 (gpmA)
Exosome [BR:cdr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CDHC03_0318 (gpmA)
  Exosomal proteins of melanoma cells
   CDHC03_0318 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEX78049
Position
323244..323990
Genome map
AA seq 248 aa AA seqDB search
MTTGKLILLRHGQSEWNASNQFTGWVDVNLTEKGEAEAKRGGELLKAQGVLPSVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKEKYGDEQFMAWRRSYG
TPPPELEDSSEFSQANDPRYANLDVVPRTECLKDVVERFVPYFKEEILPRVQNGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDEAGTVLNPGGTYLDPEAAAAGAA
AVAAQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactactggaaaactgattcttcttcgtcacggacaaagcgaatggaacgcttccaac
caattcaccggctgggtggacgtcaacctcaccgaaaagggcgaggcagaggctaagcgc
ggcggcgaactgctcaaggctcagggggtcctgccaagcgtggtttacacctctttgctg
cgccgtgctatccgcaccgccaacattgctctgaacgctgctgatcgccattggatccca
gttgttcgcgattggcgcctcaacgagcgccactacggtgcgctgcagggcctgaacaag
gctgagactaaggaaaagtacggcgacgagcagttcatggcatggcgtcgttcttatggc
accccaccaccagagcttgaggattccagcgagttctcccaggcaaacgatcctcgttat
gccaaccttgacgtggttcctcgcaccgagtgcttgaaggacgttgttgagcgtttcgtt
ccttacttcaaggaagagatcctgccacgtgtgcagaacggtgagactgttttgatcgct
gcacacggtaactccctgcgtgcattggtcaagcacctagacaacatctctgatgcagac
atcgctgagctcaacatccctaccggtattccactggtttatgagctcgacgaggctggc
acggtgctcaacccaggtggcacctaccttgacccagaagctgctgctgccggtgctgcc
gcagttgctgctcagggcgctaagtag

DBGET integrated database retrieval system