KEGG   Corynebacterium diphtheriae HC03: CDHC03_0333Help
Entry
CDHC03_0333       CDS       T01695                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDHC03_0333 (hemB)
Enzymes [BR:cdr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CDHC03_0333 (hemB)
Exosome [BR:cdr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDHC03_0333 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
335446..336438
Genome map
AA seq 330 aa AA seqDB search
MNLDLIRRPRRLRSTPVMREFVAETTLRPADLILPMFIADGIDKPREIESMPGVYQHTME
SLIEAVREAISVGIRCVDLFGVPLDSDKDATGSQAWDPEGILNRGVRALRQEFGDQVLVM
ADTCLDEFTDHGHCGILTTDRFGATIVDNDPTVELYQKMAVAQAEAGAHIVSPSGMMDGQ
ILAIREALDAAGFHDVAIMAYSAKYASAFYGPFRDAVGSSLQGDRRAYQQDPANLRESIL
EVDLDIEEGADFVMVKPAMPYLDVLAEVASTSSVPVAAYQVSGEYAMLHAAAANGWLDLD
RVMMESLISIKRAGADQILTYFAVEAARKL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatctagatcttattcgtcgtcctcgtcggttacgttcgactccggtgatgcgtgaa
ttcgttgcggaaaccacgctgcgtccggctgatcttattttgccgatgtttattgccgat
ggcattgataagcctcgggagattgagtcgatgccaggtgtgtaccagcacaccatggaa
tcccttatagaggctgtccgtgaggcgatctcggtgggtattcgctgcgtggatcttttc
ggtgtgccactggattccgataaagatgctactgggtcacaagcgtgggatcccgagggc
attttgaaccgcggtgtgcgtgcgcttcgtcaggagttcggtgatcaggtgctcgtcatg
gcggatacctgccttgacgagttcaccgatcatgggcactgtggcattttgaccacggat
cgctttggcgccaccattgtggataacgatccaacggttgagttgtatcagaagatggcg
gttgctcaggctgaagcgggtgctcatattgtgagcccgtcgggcatgatggacggccag
attttagctatccgtgaggctctcgacgccgcagggttccacgatgttgcgatcatggcg
tattccgctaaatatgcgtcggcgttttatggtcctttccgtgacgcagtgggctcctct
ttgcagggtgatcgtcgtgcctaccagcaagatcctgctaatctccgtgagtcgatcctc
gaagtcgatctggacatcgaggaaggcgcggattttgttatggtcaagcctgctatgccg
tacttggatgtgcttgctgaggtagcgtctacgtcgtcggttccggtggcggcttaccag
gtttctggtgagtatgcgatgttgcatgcggctgctgcgaacggctggttggatctggat
cgggtgatgatggagtccctgatttctattaaacgtgccggtgcggatcaaatcctgaca
tactttgctgtagaagcagcacgaaaactttaa

DBGET integrated database retrieval system