KEGG   Corynebacterium diphtheriae HC03: CDHC03_0442Help
Entry
CDHC03_0442       CDS       T01695                                 

Definition
putative regulatory protein sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDHC03_0442
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC03_0442
   00052 Galactose metabolism
    CDHC03_0442
   00500 Starch and sucrose metabolism
    CDHC03_0442
   00520 Amino sugar and nucleotide sugar metabolism
    CDHC03_0442
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDHC03_0442
   00524 Butirosin and neomycin biosynthesis
    CDHC03_0442
Enzymes [BR:cdr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDHC03_0442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
446622..447506
Genome map
AA seq 294 aa AA seqDB search
MTHALGVDIGGTKIAVGIVDSTDPTTVISRHIVPTPDHDVIDRVRDAIAHIITPEVTSIG
IGAPGVIDETTGVVVSSGPTMQGWAGTRIADTIAAEFSLPVAVHNDVRVMGLGESIYGAG
RDYTNVLFVSLGTGVGGAIVRDGRLVASPHHTAGELRALIGRLPDGRADLLENFAAGPGL
AQRFGERYPEHAGRDLRFIMDLYHAGDTHARDYITATLAAAGETIAGFASAIDVDAIIIG
GGVGNIGDAIIKPFAHGFAAHAIPPLGTIPIRQAQLGTDAPIVGAAHLGHSAIE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgcactcggtgtcgacatcggcggcactaaaatcgcagtcggaatcgtagac
agcacggaccccaccaccgtaatcagccgacacatcgtccccacacccgaccacgacgtg
attgaccgcgtacgcgacgcgatcgcccacatcatcaccccagaagtaaccagcattggc
atcggcgcgccgggcgtgatcgacgaaaccacaggagtagttgtctcctccggtcccacc
atgcaaggctgggctggcacacgcattgcggatactatcgccgcggaattttcgctaccc
gtcgccgtgcataacgacgtccgcgtcatggggctcggcgaatccatctacggcgccgga
cgcgactacaccaatgtgctctttgtcagccttgggacaggtgtcggcggagccattgtt
cgtgacggacgcctcgtagcatccccgcaccacactgcaggcgaacttcgggcactcatc
ggcaggcttcccgacggccgcgcagacctcctagaaaacttcgccgcaggacccggcttg
gcacaaagattcggtgaacgctaccccgaacacgcaggccgtgacctgcgattcatcatg
gacctctaccatgcaggagacacccacgcccgcgactacatcaccgcaacacttgcagca
gctggcgaaaccatcgcaggattcgccagcgccatcgacgtagacgccatcatcatcggc
ggcggagtaggcaacatcggcgacgccatcatcaaaccatttgcccacggattcgcagcc
cacgccattccaccgctgggcacgatccccatccggcaagcacaacttggcaccgacgca
ccgatcgtcggcgcagcacaccttggccacagcgccatcgaataa

DBGET integrated database retrieval system