KEGG   Corynebacterium diphtheriae HC03: CDHC03_0888Help
Entry
CDHC03_0888       CDS       T01695                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDHC03_0888 (folP)
Enzymes [BR:cdr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CDHC03_0888 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918290..919147
Genome map
AA seq 285 aa AA seqDB search
MTRSAFQHDPECATVMAIVNRTPDSFYDHGATHALADAITRASAVIAQGAGIVDIGGVKA
GPGPYVSPSEEIERVVPVIDAVHRAHPEITISVDTWRAEVADVAIRAGASLVNDTWAGHD
PELAEVAGHYRVGYVCSHTGGVAPRTRPHRVRFDDIVASVIEETTAQAERAVRLGVPEDR
ILIDPTHDFGKNTFHGLELLRRIDEIVATGWPVLMALSNKDFVGETLARSVDQRVAGTLA
ATAWAAAHGVAAFRSHQVAETVDVIRMTAAIQGRVPPLATTRGLV
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgactaggagtgcgtttcaacacgatcccgagtgcgcaacggtcatggcgatcgttaat
cgcaccccagattccttttacgaccacggtgcgacccatgcgttagcagatgccataaca
cgcgccagtgctgtgattgcgcagggggcggggatcgtcgatattggtggggtcaaggca
ggtcctggcccttatgtctctcctagtgaggagattgaacgggtggtaccagttatcgac
gcagttcaccgtgcgcaccccgagatcaccatttcggtagatacgtggcgtgccgaggtc
gctgatgtggcgatccgcgccggggcgtcgttagtaaacgacacgtgggccggccatgat
ccggagcttgccgaggtagcgggacattatcgcgtgggatacgtgtgttctcatacggga
ggcgtagcgccacgcacccgcccgcaccgcgtgcgtttcgacgacatcgttgcctctgtt
attgaggaaacaacagctcaagctgagcgggcggttcgccttggtgttcctgaggaccgc
attcttatcgaccccacccatgattttggcaaaaacacctttcatggactggagctgctg
cggcgtatcgatgagattgtggcaaccggctggccagtactgatggccttgtctaacaaa
gattttgtaggagagacgctggctcgctctgtcgaccagcgtgtagccggaacccttgca
gctacagcgtgggcagcggctcatggagttgcggcttttcgttcgcaccaagtcgcagaa
accgtcgatgtgatccgcatgaccgccgcaatccaaggacgcgtgccacctctggctacc
acacgggggcttgtatga

DBGET integrated database retrieval system