KEGG   Corynebacterium diphtheriae HC03: CDHC03_0965Help
Entry
CDHC03_0965       CDS       T01695                                 

Gene name
frgD
Definition
iron-siderophore uptake system exported substrate-binding protein
Orthology
K02016  
iron complex transport system substrate-binding protein
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
ABC transporters
Module
Iron complex transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:cdr02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1003493..1004536
Genome map
AA seq 347 aa AA seqDB search
MFEISRSRAKAMRPFLALATATVMMLSLAACSSSDNSSTNAQGNTDVAVGGQRFSTADQE
TAKLGSDAQPGQFPRTVVHAAGTTEITTKPERVVVLDTGELDSVLSLGITPVGMTTTKGA
NPVPSYLADKVKEVERVGTINELNIEAIAALKPDLIIGSQLRADKLYPQLSDIAPTVFSI
RPGSPWKENFLLVGEALGMEKEAEEKLNEYADRVAELKNNVPQNTEVSLVRFMPNKLRLY
GNKSLIGVVLADAGLARPEKQNVDDLAVEISPENIDQAAGSVIFYTSYGKPDATGETAVV
EGPAWKNLEAVAAGKAHRVNDDVWFLGLGPTGAMEIVSDLHDYLLKK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaatatcccgatctcgtgcgaaagcaatgcgtcctttccttgccctcgccaca
gccactgtaatgatgctgtccctcgcagcgtgttcttcttctgacaattcctcgactaac
gctcaaggtaacactgatgttgccgtgggtggccagcgttttagcaccgctgatcaagaa
actgccaagcttggtagtgatgcacaacctggtcaattcccacgtaccgtcgttcatgct
gctggaacaacggagatcacaacaaagcccgagcgtgttgttgtccttgataccggtgaa
ttagatagcgtcttgtctcttgggatcaccccagtaggaatgaccactaccaagggtgct
aatccagtgccgagctatctcgccgataaggtaaaagaagtggagcgagttggcactatc
aacgagcttaatatcgaggcaattgctgctttgaagcccgacctgattattggttcgcaa
ttgcgtgccgacaaactgtatccgcagctttctgacattgcgcctacggttttttccatc
cgaccaggttctccatggaaggaaaacttcctcctcgttggtgaggcacttggaatggaa
aaagaagcggaagaaaaactgaatgagtatgctgaccgcgttgctgagttaaagaataac
gttcctcaaaatactgaggtttctctcgttaggtttatgcctaacaagctgaggctgtat
ggaaacaagtcgttgatcggtgttgttcttgccgatgctgggcttgctcgcccagaaaaa
caaaacgttgatgatcttgctgttgaaatttctccagaaaacatcgatcaagctgcagga
tcggtcatcttctatacttcctacggaaagccagatgctacaggggaaaccgctgtagtt
gaggggccggcatggaaaaaccttgaagcagtggctgcgggtaaggcccaccgcgttaat
gacgatgtgtggttccttggtctagggccaacaggcgctatggagattgtctcggacctt
cacgactacttactgaagaaataa

DBGET integrated database retrieval system