KEGG   Corynebacterium diphtheriae HC03: CDHC03_1231Help
Entry
CDHC03_1231       CDS       T01695                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cdr00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1303790..1304365)
Genome map
AA seq 191 aa AA seqDB search
MSGDNPVGRLVVLAGPSAVGKSTVVHRLREEIEDLYFSVSMTTRAPRPGERDGVDYFFVS
PEEFQSKIDAGEMLEWADIHGGLQRSGTPAGPVEAALLAGRPVLVEVDLVGARNVASLKP
ESETVFLAPPSWEVLVERLTGRGTEPEDVITRRLETAKNELTAQHEFKHVVVNEDVEKAV
SDIKEILVGRR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgataacccagtaggccgtctggtggtactcgcagggccttctgccgtgggt
aaatccacggtggttcatcgcctccgcgaagaaattgaagacctctacttcagcgtatct
atgaccacgcgtgctcctcgaccaggagagcgcgatggcgtggactatttttttgtgtca
cctgaagagtttcaatccaagattgatgcgggggagatgctggaatgggctgatattcac
ggtggtcttcaacgttcgggaactcctgcgggacctgttgaagctgcacttctggccggt
cgacctgttctcgttgaggtggatttggtcggtgcgcgaaacgtggcatcgctaaaacct
gaatctgagactgtatttttagccccgccatcgtgggaagttttagtggaacgtctgaca
ggacgtggtactgaacccgaagacgtaattactcgtcgactggaaacagcgaagaatgaa
cttactgctcagcatgagttcaaacacgttgttgtcaatgaggacgtggaaaaagctgtg
tcggacatcaaggaaatccttgtcggccgtcgttaa

DBGET integrated database retrieval system