KEGG   Corynebacterium diphtheriae HC03: CDHC03_1531Help
Entry
CDHC03_1531       CDS       T01695                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
cdr00010  Glycolysis / Gluconeogenesis
cdr00052  Galactose metabolism
cdr00500  Starch and sucrose metabolism
cdr00520  Amino sugar and nucleotide sugar metabolism
cdr00521  Streptomycin biosynthesis
cdr01100  Metabolic pathways
cdr01110  Biosynthesis of secondary metabolites
cdr01120  Microbial metabolism in diverse environments
cdr01130  Biosynthesis of antibiotics
cdr01200  Carbon metabolism
Module
cdr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC03_1531 (glk)
   00052 Galactose metabolism
    CDHC03_1531 (glk)
   00500 Starch and sucrose metabolism
    CDHC03_1531 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CDHC03_1531 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDHC03_1531 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CDHC03_1531 (glk)
Enzymes [BR:cdr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDHC03_1531 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase TCR Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AEX79258
Position
complement(1629016..1629969)
Genome map
AA seq 317 aa AA seqDB search
MTNMSESVTVGFDIGGTNMRAAAVTDSGLIIDSVSVPTPKSSEALEKGIISLVAQLREKH
EVSAVGLAVAGFLDPDCEIVRFAPHLPWRDRPVRAELEDALGLPVRLEHDANSAAWGEYR
FGAARGSQNWVLFAVGTGIGATLMHEGEIYRGAFGTAPEFGHLTVVPQGRQCSCGKSGCL
ERYCSGTAIEATARELLDADRGRDSMVAAAYHSGTLSGKTVTEAARQGDVFAIEVFYDFA
EWMGRALSIVCDVLDPGQIVIGGGLSTSSDLFLEKATQHMAQQIVGAGYRPLPTVVCAEL
GGDAGMIGVSDLARRRV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatatgtcagaatctgtcactgtcggattcgacatcggtggaaccaatatgcgg
gcagcggcggtgacggattccggtttgatcatcgactccgtttcggttcctacccctaaa
tcttctgaggctctggaaaaaggcattatttctctggtagctcaattgcgggaaaagcat
gaggtttcggctgtaggtcttgccgttgcaggttttttggatcctgattgcgaaatcgtt
cgctttgctcctcatctgccgtggcgtgatcgcccagtgcgtgcggaattagaggacgcg
ttgggacttcctgttcgtcttgaacatgatgcgaattctgcagcgtggggagaataccgc
ttcggagcggcacgtggttcgcaaaactgggtcttatttgcggttggcactggtatcggt
gccacactgatgcatgagggtgagatctaccgtggtgcttttggtacagctcctgagttc
ggccaccttaccgttgtccctcaaggtcggcagtgttcttgtggcaagagtggctgtttg
gaacgttattgttccggcactgctattgaagcgacagcgcgtgagcttctcgacgccgat
cgtggccgcgactcgatggttgctgctgcttatcattcgggcacattgagtgggaaaact
gtgaccgaagcggcccgccagggtgatgtttttgccatcgaggtcttttatgattttgct
gaatggatgggccgcgccttgtctatcgtgtgtgatgttttagatccgggacagatcgtg
attggtggcgggttgtccacgtcaagcgatttgttcttggaaaaggctactcagcacatg
gcacagcagattgtcggggctgggtatcgcccccttccgacggtggtgtgtgccgaattg
ggtggcgatgccggtatgatcggggtatctgatctggctcggcgtcgcgtctag

DBGET integrated database retrieval system