KEGG   Corynebacterium diphtheriae HC03: CDHC03_1542Help
Entry
CDHC03_1542       CDS       T01695                                 

Gene name
ltsA
Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cdr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1640771..1642693
Genome map
AA seq 640 aa AA seqDB search
MCGLLGMLSSTGQASKYVDAIESALPCMHHRGPDEAGTWHDDHAVFGFNRLSIIDLEHSH
QPLRWGPEGEPDRYAMTFNGEIYNYVELRKKLQDLGYTFNTSGDGETIAVGFHHWGADVV
LHLRGMFGIAIWDTKEQRLFLARDQFGIKPLYFATTEAGTVFASEKKCILDMADAIGLDL
GLDQRAIEHYIDLQYVPEPESLHQHIRRLESGCFAFVSVGGNVDQTRYFRPQFPAQEFPK
DKEQDLFDRIAKALEDSVEKHMRADVTVGSFLSGGIDSTAIATLAKRHNPNLLTFTTGFE
REGYSEVDVAAESAAAIGVEHIVKIVSPEEYANAIPQIMWYLDDPVADPSLVPLFFVAQE
ARKHVKVVLSGEGADELFGGYTIYKEPLSLAPFEKIPSPLRRGLGKVAEVFPDGMRGKSL
LQRGSMTMEERYYGNARSFNFDQMKRVIPWAKKEWDHREVTAPIYAQSEHMDPVARMQHL
DLFTWMRGDILVKADKINMAHSLELRVPFLDKEVFEVAETIPYDLKIANGTTKYALRKAM
EQIVPPHVLHRKKLGFPVPMRHWLAGDELFGWAQDTINESMTDQYFDKAAVLAMLNEHKN
GVSDHSRRLWTVLAFMIWHGIFVEHRIDPGIEKRDYPVYL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggacttctaggcatgctctccagcacaggacaggccagtaagtatgtagatgct
atagaaagtgctttgccgtgcatgcaccaccgaggccctgacgaagcaggtacttggcat
gacgaccatgcagtttttggctttaatcgcctatcgattatcgatctcgagcattctcac
cagcccttgcgatgggggcctgaaggcgagcccgaccgctatgccatgacttttaatggc
gagatctacaactatgtagagctacgaaaaaaacttcaagacctcggctacacctttaac
acttcaggcgacggcgaaactattgctgtcggtttccaccactggggtgcagatgtagtg
cttcacttgcgcggaatgtttggcatagccatttgggacaccaaggaacaacgtcttttc
ttggcccgcgatcaatttggtatcaagccgttgtactttgctaccaccgaagctggcacc
gttttcgcctccgagaaaaagtgcatcttggatatggcagatgctattggtctagatttg
gggcttgaccaacgtgctatcgagcactacatcgatcttcaatacgttccagagcctgaa
agtcttcatcagcacattcgacgcctagagtctggctgctttgctttcgtttctgtggga
ggcaatgtcgatcagactcgttacttccgtcctcagttccccgcacaagaattcccaaag
gacaaggaacaggatctcttcgatcgaatcgccaaggccctagaagatagcgtcgaaaag
cacatgcgtgccgacgtcactgtcggttctttcctgtctggcggcatcgactccactgcg
attgcaactttggcaaaacgccataatccgaatctgttgacattcactacaggatttgaa
cgcgaaggatattcggaagtcgatgtggctgcagaatccgctgctgccattggagtagaa
catatcgtcaagattgtctctcccgaggaatatgccaatgccattcctcaaatcatgtgg
tacttggatgacccagtagctgatccctccctagtcccactattcttcgttgctcaagaa
gcccgcaagcatgtcaaagtggtgttgtcaggcgaaggagcagacgaactatttggtggt
tacaccatttacaaagagccgctttctcttgctccatttgaaaagattccttccccgcta
cgtcgcggtcttggcaaagtagccgaagttttccctgacggaatgcgtggtaaatccttg
ctccaacgcggttcaatgacgatggaagagcgttattacggaaatgctcgttccttcaat
tttgatcaaatgaagcgcgttatcccatgggccaagaaggaatgggatcaccgcgaagtc
accgcaccgatctacgcccagtctgagcacatggaccccgttgcgcgaatgcagcatttg
gatcttttcacgtggatgcgcggcgatatcctcgtcaaggccgacaagatcaacatggct
cactccttggaacttcgcgtcccgttcttggataaggaagtatttgaggttgctgaaacc
attccttatgacctcaagattgctaacggaacgaccaaatatgcgttgcgtaaggccatg
gaacaaatcgttccgccgcacgtgctgcaccgcaagaaactcggattcccagtgcctatg
cgacactggctagctggcgatgagctgttcggttgggctcaagacaccattaatgagtcg
atgaccgaccaatactttgacaaggcagcagtcttagcaatgctcaatgaacacaagaat
ggtgtatctgatcattcccgcaggctatggacagtcctcgcctttatgatttggcacgga
attttcgtcgagcaccgcattgatccaggcatcgagaaacgcgattatcctgtgtaccta
tag

DBGET integrated database retrieval system