KEGG   Corynebacterium diphtheriae HC03: CDHC03_1624Help
Entry
CDHC03_1624       CDS       T01695                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CDHC03_1624 (malQ)
Enzymes [BR:cdr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CDHC03_1624 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1726978..1729146
Genome map
AA seq 722 aa AA seqDB search
MSYSDLLRELAAAHAISSSYSGFGGAHVEVSDDTLVKTLRSLGVCFGNEDEPATDHEPLT
GPMPSEDQIRYALQQRYDAEATRPLPRCVVAVEGDPYVFNVHVHDGAPADITITLEDGST
AEVTQVENWTPPREVDGITWGEASFQLPSDLPLGWHTITLTSDTLTSSCFLIVTPARLST
ADKYTENPVSGVMAQLYSARSKNSWGMGDFNDLGLLAETLAPQADYLLINPLHAAEPMPP
VEDSPYLPTTRRFINPIYIRIEDIPEHLLLDDDLQNDIAELAEKFTALNLTPEKIERNAI
FDAKLQVLHAVFNVEREPAREQDFQDFIATEGQGLRDFASWCADQELAVLESSAAHAALP
EKESLIQFYMWQQWICDQQLGAAQTRATDAGMSIGIIADLAVGIHPAGADALSLADTLVA
RASVGAPPDSYNHQGQDWSQPPWHPDRLAESGYIPWRDLLRTVLRHAGGVRVDHILGLFR
LFWIPRTQSPQTGTYVNYDHNALVGVLALEAERAGAVVIGEDLGTFEPWVQDFLASRGIM
GTSVLWFESSPEGGPRKQHEYRQLALTSVTTHDLPPTAGYLAGEHIALREDLGILTTDVA
TEYAEDLNWQADILNVVRNSGAFESIVPADFHGVDRADRGSSVELLSALHRFLAGTPSAL
SCTALVDLVADKRAQNQPGTTSDQYPNWCIPLCDESGTPVLIEDLAENPVYQAVTKASTR
LH
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtgagttactcagatttgttacgcgagctggccgctgcccacgcaatctcttcgtcgtac
tccggtttcggtggagcacacgtggaagtttcggatgacacgctggtcaagaccctgcga
tccctcggagtttgcttcggaaatgaagacgaacccgccaccgaccacgagcctttgact
gggcctatgcctagcgaggatcaaattcgctacgcgctgcaacaacgttacgacgccgaa
gcaacccgccccctcccccgatgtgtggttgccgtcgaaggcgatccctacgtgttcaac
gtccatgttcacgacggtgctcccgccgacatcaccatcactttggaagatggttcaacc
gcagaggttacccaggttgaaaactggaccccaccccgtgaagttgatggcattacttgg
ggtgaagcttccttccagctgccgtccgaccttccactgggctggcacaccatcaccttg
acctccgacacgctaacgtcaagctgcttcctcatcgtgaccccggcgcgtctatctacc
gccgataagtacacagaaaatcctgtcagcggtgttatggcacagctgtactctgctcgt
agtaagaattcttggggcatgggtgacttcaatgacctcggcctgctggctgagacgctc
gccccgcaggctgattatctgttgattaatcctctgcacgctgctgagccgatgccacca
gtggaggattccccatacttgcctactacgcggcgttttatcaacccgatttatatccgc
atcgaagatatccctgagcacttgcttctcgacgatgacctacaaaatgatatcgccgaa
cttgcggaaaagttcactgcccttaatctcacccctgaaaagattgagcgcaatgcaatt
tttgatgccaagttgcaagtgctgcacgcggtattcaatgtagagcgcgaaccagcacgt
gaacaggacttccaagacttcattgccaccgaaggccaaggcctacgcgacttcgcttca
tggtgtgcagatcaggagctagcagttctggagagctccgcagcacatgccgctcttccg
gaaaaagagtctcttatccagttctacatgtggcagcagtggatttgcgatcaacagctt
ggtgctgctcaaacccgcgcaaccgacgctggaatgagcatcggtatcatcgccgatctc
gcagtgggcattcatcctgcgggtgccgatgcactttcgcttgccgacaccctagtcgcc
cgcgcttctgtgggggcgccaccagatagctacaaccaccaaggccaagactggtctcag
ccaccatggcacccagaccgcttggctgagtccggctatatcccatggcgtgacctgctg
cgcacggtgctgcgccacgccggtggtgtccgtgtagaccacattcttggtcttttccgc
ttgttctggattccacgtacgcagtctccacaaacgggtacttacgtcaactacgatcac
aacgcacttgtgggcgtacttgctttggaagcagagcgtgcaggcgcagtggttattggt
gaagacctcggtaccttcgagccatgggttcaagacttccttgcgtcccgaggtatcatg
ggtacttcagtgctgtggttcgaaagttccccagaaggtggccctcgcaagcagcacgag
taccgtcagttggcgctgacctcggtaaccacccatgatctgccaccaacagcgggctat
ctggcaggcgagcacattgcgttgcgtgaggacctcggaattttgaccaccgatgtagca
actgagtatgccgaggatttgaactggcaggcagatatcctcaacgtggtccgtaactcg
ggcgcatttgagtccatcgttcctgcagatttccacggtgtagatcgtgctgaccgcggc
agctccgtcgaattgctttccgcacttcaccgcttcttggctggtacgccatcagcactg
tcctgtaccgcattggtggatctggtagccgataagcgtgcgcagaaccagccgggtact
acttcggatcagtacccgaactggtgtattccgctatgcgacgagtccggcactccagtc
cttatcgaggacttggccgaaaaccccgtctatcaagcggtaacaaaggcgtcgactcgc
ctacattag

DBGET integrated database retrieval system