KEGG   Corynebacterium diphtheriae HC03: CDHC03_1676Help
Entry
CDHC03_1676       CDS       T01695                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
cdr00330  Arginine and proline metabolism
cdr00332  Carbapenem biosynthesis
cdr01100  Metabolic pathways
cdr01130  Biosynthesis of antibiotics
cdr01230  Biosynthesis of amino acids
Module
cdr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CDHC03_1676 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CDHC03_1676 (proB)
Enzymes [BR:cdr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CDHC03_1676 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEX79403
Position
complement(1779858..1780988)
Genome map
AA seq 376 aa AA seqDB search
MNAQHSSADLRDVIRNAKRIVVKIGSSSLTDENFEVSPGRIDRIVEALEDRMQRGSDVIV
VSSGAVAAGMAPLGLTSRPKDLATKQAAASVGQVHLANAWGNSFARYNRTIGQVLLTASD
AGQRDRARNAQRTIDRLRLLHAVPIINENDTVATSEMHFGDNDRLAAIVSHLVSADALVL
LSDVDGLYDKNPADPSARFVSEVRDGNDLKGVIAGDGGAVGTGGMASKVSAARLASRSGV
PVLLTSADYVAEALGDAEVGTVFYPKDDRLSAWKFWALYAADTGGALRIDAGAVSAVTAG
GNSLLAVGITEVIGDFHAGEIVEILGPEGEIIGRGEVAYDSAVLTTMLGKQTAQLPDGLQ
RPVVHADYLSDYASRA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcccagcacagcagcgccgatctgcgcgacgtgattagaaacgctaagcggatt
gtggtcaagattggttctagttcactgaccgacgaaaattttgaggtctctccggggcgt
atcgaccgcattgtggaggctctagaagatcgtatgcagcgcggttccgacgtgattgtt
gtatcttctggtgctgtggctgctggtatggctccattggggttgacttcacggccgaag
gatttggcaacaaagcaagctgccgcctcggtggggcaggtgcatttggctaatgcgtgg
ggtaatagttttgcccgctataaccgcacgattggccaggtgctgttaacggcctccgac
gcaggccagcgggatcgtgctcgtaatgcgcagcgcactattgatcgcttgcggttgcta
cacgcagtgccgattatcaatgagaatgacacggttgcaacttctgagatgcactttgga
gacaacgatcgccttgccgcgattgtgtctcacctagtgtccgcggacgcattggtgctg
ctctcggacgtagatgggttgtatgacaaaaaccctgcggatccttcggcacgatttgtg
tctgaagtcagagacggcaacgacctgaaaggtgtgatcgcaggcgacggtggggccgtg
gggaccggtggcatggcgtcgaaggtgtcggccgcgcggttggcgtcgcgaagcggcgtg
cccgtgttgttgacctccgctgattatgtggccgaggcgctgggcgatgctgaggtgggt
acggtgttttaccccaaggatgatcgcctatcggcttggaagttttgggcgctgtacgct
gcagatactggcggcgcattgcgtatcgacgccggcgcggtctccgcagtcaccgccggc
ggaaactccttgcttgccgtgggcattaccgaggttattggagattttcacgctggtgag
atcgtggagattctaggccctgaaggtgaaatcattggacgaggtgaggtggcctatgat
tccgcagtgctcaccaccatgctgggcaaacaaaccgcgcagcttcctgatggtttgcaa
cgtcctgtggtccatgctgattatctttccgattacgcgtcacgcgcgtag

DBGET integrated database retrieval system