KEGG   Corynebacterium diphtheriae HC03: CDHC03_1871Help
Entry
CDHC03_1871       CDS       T01695                                 

Gene name
folK
Definition
putative 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cdr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2000912..2001391)
Genome map
AA seq 159 aa AA seqDB search
MRAVLSIGSNMDDRYALLRTVVEEFAGEIVAASSIYSTPPWGVEDQDEFLNAVVIVDVDS
SPLELLRRGQRLEEAACRRRLRHWGPRTLDVDVVTIYNDDGTPMVSSDPELTLPHPYAHE
RAFVLVPWAEADPEAELLGQKVAQRAAALGETFPVVGSL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagtgctttctattggttcgaatatggatgaccgctatgccttgctgcgaacg
gttgtcgaagaattcgcgggagagatcgtggcagcatcctcgatctattccacgcccccg
tggggagtagaggaccaagacgagttcctcaacgcggtcgtcattgtggacgtcgatagt
tcaccccttgagctgctaagacgtggccagcgcctagaagaagccgcgtgtcgacgtcgc
ctgcggcactggggtccgcgcaccctagacgtcgacgtcgtgaccatctacaacgacgac
ggcacccccatggtatccagcgaccccgagctgactctgccgcacccatacgcccacgag
cgagcctttgtgcttgtgccttgggcagaagcagaccccgaagctgaattgctaggccag
aaagtagcgcagcgcgccgcagcactgggcgaaacatttccggtggtgggaagcctatga

DBGET integrated database retrieval system