KEGG   Corynebacterium diphtheriae HC03: CDHC03_1948Help
Entry
CDHC03_1948       CDS       T01695                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CDHC03_1948 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDHC03_1948 (mhpF)
   00650 Butanoate metabolism
    CDHC03_1948 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    CDHC03_1948 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDHC03_1948 (mhpF)
   00622 Xylene degradation
    CDHC03_1948 (mhpF)
   00621 Dioxin degradation
    CDHC03_1948 (mhpF)
Enzymes [BR:cdr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CDHC03_1948 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2095667..2096590
Genome map
AA seq 307 aa AA seqDB search
MTKKLSAAIVGPSNIGTDLMLKLLKNSEHVEPKFMIGVDPSSDGLRRASEHGLVASAEGV
DWLLQQDPLPDLVFECTSATAHAAHAPKYAQAGIRAIDLTPAAVGPYLCPSVNLDDLAAV
DNVNMITCGGQATTPIVKAVSQVVDVDYAEIVSSIPSRSAGPGTRANIDEFIKTTQTAVE
KLGGAYKSKVILILNPVEPPMLMRNTVYCALPAQAGTDQALQEEIRASIDRMVASVQRYV
PGYHLTAEPQFDEARDDWGGWARVTVLIEVKGAADYLPEFAGNLDIITSAAVATADRYAE
ILANTQS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaaacttagtgctgccatcgtaggacctagcaacattggtactgatttaatg
ctcaagctgctgaagaattcagagcatgtggaaccgaagttcatgattggtgtggacccc
agttcggatgggcttcgtcgcgcatctgagcatggtcttgtcgcttcggctgagggcgtg
gattggttgttgcagcaggatccgctgccggatctggttttcgagtgcacgtctgctact
gcgcatgctgcacatgctccaaagtatgcgcaggctggaattcgcgctattgatctcacc
cctgctgctgtgggcccgtacctgtgcccttcagtcaacttggatgatttggcggcggtg
gataacgtcaacatgattacctgcggtggccaagccactacgccgatcgtcaaggcggtg
tctcaggtcgttgatgtggactatgcggagattgtgtcatcgattccttcacgctcggca
ggccctggcacccgcgccaatattgatgagtttattaagactacgcagactgccgtcgaa
aagcttggtggtgcgtataagagcaaggtcattttgattttgaacccggtggagccacca
atgctcatgaggaatacggtgtactgtgcgctgccggcgcaggcggggactgatcaggcg
ctgcaggaggagattcgagcgtcgattgatcgcatggttgcgtcggtgcagcgttatgtg
cccggctaccacttgactgcggaaccacagttcgacgaggcccgcgatgattggggcggc
tgggcgcgcgtgaccgtattgatcgaggtcaaaggtgccgccgactatttgcccgagttc
gcgggaaacctagacattattacttccgctgcggtagctacagctgatcgctacgcggaa
atcttggcgaacactcaaagctaa

DBGET integrated database retrieval system