KEGG   Corynebacterium diphtheriae HC03: CDHC03_2233Help
Entry
CDHC03_2233       CDS       T01695                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC03_2233
Enzymes [BR:cdr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CDHC03_2233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2440183..2440965)
Genome map
AA seq 260 aa AA seqDB search
MSDQIADARLVPLGAILTRMSTIVDMPETRGHLISAITTASDPGEILYLSSRADFSEGGS
IRGGVPIIAPWFAKNLGHDELQHGWARRVEWETIPTNGGIDARTSHDDWDLRLGTQVLPH
GFAMMLKARNASPLRRDFQSAFHPYFRVADVRTTTVTVGDQEFRFDGTAVDQAVPLPEWT
PLVIKDSQRTITVTYQGADHAVVWNPGSELAAQMTDVGEGEWTEFVCVEPALLGDHAQGI
SVPPWDWVEIGMTVKVTPAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatcaaattgcagacgcgcggctcgtgccgttgggggctatccttacaagaatg
agcaccattgtagatatgcctgagactcgcggacatttgatatctgcgattactaccgcc
agcgatcctggcgaaattctttacttatccagtcgcgcggatttttccgagggtggttcg
atccgtggcggtgtcccgatcatcgcaccgtggtttgctaagaacttgggacacgatgag
ttgcagcatggttgggcgcgccgagtggagtgggagacgatccctaccaatggcggtatc
gacgcccgcacgagccacgatgattgggatctgcgccttggcacgcaggtacttcctcat
ggttttgccatgatgttgaaggcccgcaacgcttccccactgcgtcgcgatttccaatcc
gcgttccacccgtatttccgcgttgctgacgtgcgcaccaccaccgtaacggtgggcgat
caggagtttcgtttcgacggcaccgccgtcgaccaagcggttcctctgccagagtggacg
ccgctggttatcaaggattcccagcgcactattactgtcacctaccaaggtgccgatcat
gctgtggtgtggaatcctggcagcgagcttgccgcacagatgacagatgtgggcgaaggt
gaatggaccgagtttgtttgtgtagaaccagcattgttgggtgaccacgcccaaggtatt
tctgttcccccttgggattgggtagagatcggcatgaccgtgaaggtcacaccggctcag
tga

DBGET integrated database retrieval system