KEGG   Corynebacterium diphtheriae HC03: CDHC03_2239Help
Entry
CDHC03_2239       CDS       T01695                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDHC03_2239 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDHC03_2239 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDHC03_2239 (trpB1)
Enzymes [BR:cdr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDHC03_2239 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2446425..2447756
Genome map
AA seq 443 aa AA seqDB search
MTDSTLRKTLISAYFGNYGGQFVPDALLPVLDELEQAYVDALNDPEFSRELARLQKHYLG
RPTPITECANLPLAGKGKGKARIFLKREDLVHGGAHKGNQVLAQALIARRLGKTRLIAET
GAGQHGTATAMVAALMGMDCTIYMGAKDVARQQPNVYRMRLMGATVVPVTNEHGDSMSDA
IDVALMDWVENLDTTHYLIGSAVGPHPFPTLVKEFQAVISRESREQMLELTGKLPDAVIA
AVGGGSNAIGAFADYLTDKLGNESVRLIGVEPAGEGLDSGKHGAPLQRGKVGVQHGFKSF
ILADEQGNPLHSYSVSAGLDYPGVGPEHAHLMESGRAQYYGITDAEALQAFRMLSRYEGI
IPALESSHALAYTLKMAENAEETDTPINIVVNLSGRGDKDVDYVRNILGDLATEDPATSP
VTDPHVAETLATMIAESNAREGV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaccctccgtaagacgttaatcagcgcctactttggtaactacggcgga
cagtttgttcccgatgcgctcctgccggttctcgacgaactagagcaggcctatgtggat
gcactcaacgacccagagttttcgcgggaacttgctcggctacaaaagcactaccttggt
cgtcccactcctattaccgaatgcgctaacctccccctagcgggtaaggggaagggtaag
gcgcggatcttcctcaaacgcgaggatctagttcacggtggcgcgcataagggcaatcag
gtgcttgcccaggcgttgattgctcgcagattgggtaaaactcgtttgatcgcagaaacc
ggtgctggtcagcacggtaccgccactgcgatggtggcggctttgatgggaatggactgc
accatttatatgggtgctaaagatgtggcccgccagcagcccaatgtgtatcgcatgcgg
ctcatgggggctacggtggtgccagtaaccaacgagcatggtgattccatgtcggatgct
atcgacgtagcgcttatggactgggtggaaaacctagataccacgcactacctgattggt
tctgcggtcggtccacatccgttccctacgctggtcaaggagtttcaggcggttatttcg
cgggaatctcgcgaacagatgctggagctaacaggcaagcttccggacgcagtgattgct
gccgtaggcggtggttcgaatgctattggtgcgtttgctgattacctcacggataagcta
ggtaatgagtccgtgcgtttgattggtgtggagccagcaggtgagggtcttgattccggt
aagcatggtgcgccgctgcagcgtggcaaggttggtgtgcaacacggcttcaagtcgttc
atcttggctgatgagcagggcaatccgctgcattcttattccgtatcggctggtcttgat
tatccgggcgtgggtccagaacacgcccacctcatggaatctggtcgtgcacaatattat
ggaattaccgatgccgaggcgcttcaggcattccgaatgctaagccgctacgagggtata
attccagctttggagtctagccatgcgttggcctataccctaaagatggcggaaaacgct
gaggaaaccgatactcccattaacattgtggtcaatctttcaggtcgtggcgataaagat
gtggactatgttcgcaatatcttgggcgacctcgctaccgaggatccagcaacctcacca
gtcacggatcctcatgtcgccgaaaccctcgccacaatgatcgctgagtccaatgcacga
gagggggtctaa

DBGET integrated database retrieval system