KEGG   Corynebacterium diphtheriae HC03: CDHC03_2243Help
Entry
CDHC03_2243       CDS       T01695                                 

Gene name
trpC1
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
cdr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdr01100  Metabolic pathways
cdr01110  Biosynthesis of secondary metabolites
cdr01130  Biosynthesis of antibiotics
cdr01230  Biosynthesis of amino acids
Module
cdr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDHC03_2243 (trpC1)
Enzymes [BR:cdr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CDHC03_2243 (trpC1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CDHC03_2243 (trpC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEX79968
Position
2450986..2452443
Genome map
AA seq 485 aa AA seqDB search
MQNDSSTRPMPTVLESIVSGRRSHLPEIQARISHVDPARLPRSTRSLFHALGGHSDGGPA
LRGSAHFIMECKSSSPSLGMIREDYRPGDIARVYSHYAAGISVLCEPDRFGGDYNHLATV
AATTHLPVLCKDFIIHPAQVHAARYFGADAILLMLSVLDDATYTELSQEAARLGLDVLTE
VIDEVEVERAIRLGATIFGINHRNLHDLSIDLNRSARLAQLIPDSAVIVSESGIRDNETV
RQLSGHSSAFLVGSQLTSQPDVDRAARELVYGHNKVCGLQSPSEAQAARASGAIYGGLIF
EESSPRNVSRETSKKIMAAEPELTYVAVSRRTTGWAEIIGDNIAVAQIHSPYQGSIAAEK
ELINHVRGEVGDKVKIWCAVSMTHADGSLVAEALAPEVDRLVLDTGNGGTGTAFDWARIP
ESVKSKALLAGGIGPDNITEALAVGCAGLDLNSGLEYPADAGKWAAHKDAAAIHSTFTQI
RGFHY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgattcgtcgacacgccccatgcccaccgtcctagaatccatcgtttcgggc
cgacgatcccacctgcccgaaatccaggcgcggatttcccacgtggacccagcgcgacta
ccgcgttccacccgctccttgttccacgccttgggaggccatagcgatggcggtccggcg
ttgcgggggagtgcgcactttatcatggagtgcaagtcctcctcgccgtcgcttggcatg
atccgcgaggattatcgccctggcgacatcgcgcgggtgtattcacattatgcggccggc
atttcggtgttgtgcgagccggatcgttttggcggcgactataaccatctggccacggtg
gcggccacgacacatctgccggtgctgtgcaaggattttattatccaccccgcacaggtt
cacgcggcacgttattttggggcggacgcaattttgctcatgttgagtgtgcttgacgac
gccacctacaccgagctcagccaggaagcagcacgcttggggttggatgttctcaccgag
gttatcgacgaggttgaggtggaacgtgccattcggttgggggccacaatctttggcatt
aatcatcgcaatctgcatgacttgagcattgatttaaatcgctcagcacgccttgcgcag
ctgattcccgatagcgccgtgattgtctccgagtctggcattcgggataacgagacggtt
cgccaactcagcgggcattccagtgcgttcctcgtaggctcgcagcttacttctcagcca
gatgtggaccgcgcggcccgtgagcttgtgtacggccacaataaggtgtgcggtttgcag
tcgccaagcgaggcgcaagcagcgcgcgcatcgggtgcaatctatggcggattgatcttc
gaggagtctagtccgcgtaatgtttcacgtgaaacatcgaaaaaaatcatggctgccgaa
cccgaacttacctatgtcgccgtctcacgacgcaccaccggatgggccgaaatcataggt
gacaacatcgccgttgctcagattcacagtccttaccagggctccatcgccgccgaaaaa
gaactcattaaccatgtgcgcggcgaggtaggagacaaggtaaaaatctggtgtgcggtc
tccatgacgcatgccgacggctcccttgtcgccgaggcgctcgcacccgaggtagacaga
ctcgtcctcgacaccggcaatggcggaaccggcaccgccttcgattgggcacgcatccca
gaatccgtgaagagcaaggctcttctcgccggcggcattggaccagacaatatcaccgag
gcactcgccgttggctgcgcgggactcgacctcaactccgggttggaatatccagccgac
gcagggaagtgggcagcacacaaagacgctgctgcaatccactccactttcacccaaata
cgtgggtttcattactaa

DBGET integrated database retrieval system