KEGG   Corynebacterium diphtheriae HC03: CDHC03_2247Help
Entry
CDHC03_2247       CDS       T01695                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDHC03_2247 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDHC03_2247 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDHC03_2247 (trpB2)
Enzymes [BR:cdr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDHC03_2247 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2454865..2456091
Genome map
AA seq 408 aa AA seqDB search
MKHTLLPAYFGEFGGQYVPESLIPALDQLEAAFVEAQNDPEFRAELAGYLKDYLGRPTPL
TLCSKLPKAGKGKGHARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKTRIIAETGAGQH
GTATALACALLDLDCVIYMGAKDVERQQPNVYRMELMGAKVVPVDSGSGTLKDAVNEALR
DWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQILEQTGALPDVVVACVGGGS
NAIGMFADFIDDPSVELVGAEPGGMGLSSGKHGATINNGQIGILHGARSYLMRNSDGQVE
ESYSISAGLDYPGVGPQHAHLAKSGRARYVAITDAEALEAFQLLSREEGIIPALESSHAL
AYALKRAALAEENNEDITIVVSLSGRGDKDIDHIRRTLSAHPELVVKD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacacactgctaccggcatacttcggagaattcggcggacaatacgtacccgaa
tcccttatccccgccctcgaccaattagaagcggccttcgtggaagcgcaaaacgatccc
gagtttagagccgaactcgccggatacctcaaggactacctcggtcgtcccacaccgctc
acgctctgctccaagctacccaaagccggaaaagggaaggggcacgcgcggatcttcctc
aaacgagaagacctcgttcacggcggcgcacacaaaaccaaccaagtaatcggccaagcc
ctcttagccaaacgcatgggtaaaacccgcattattgctgaaaccggtgccggacaacac
ggaaccgccaccgcactcgcatgcgcactgctcgacctcgactgcgtgatctacatgggc
gctaaagacgtggaacgccaacaacccaacgtgtaccgcatggagctcatgggcgccaag
gtcgtaccagtcgactccggctccggaaccctcaaagatgcagtcaacgaagcactgcgc
gattggaccgcaaccttccacgagtcacactatctgctcggcaccgcagccgggccacac
ccatttcccacgattgtgcgcgaattccaccgcgtaatctcagaagaggccaaagcccaa
atacttgagcaaaccggtgcactgccagatgtggtggtcgcctgcgtcggcggcggatcc
aacgccatcggcatgttcgccgactttatcgacgacccctcagtagaactcgtcggcgca
gaaccaggcggaatgggactaagctccggaaaacacggcgctaccatcaacaacggccaa
atcggtattttgcatggcgccagaagctacctcatgcgcaactccgatggccaagtagag
gaatcctattctatttcagccggcctcgactacccaggtgtcggcccacaacacgcccat
ctagcaaagtctgggcgcgcccgctatgtcgccatcactgatgcggaagcactcgaagca
ttccaattgctctcccgcgaagagggcatcatcccggccttggaatccagccacgctctt
gcctatgcactcaaacgtgccgccctcgctgaggaaaacaacgaagatatcaccatcgtg
gtgtccttgtctggccgtggcgacaaagacatcgaccacatccgccgcactctttccgcc
cacccagagctggttgtaaaggactaa

DBGET integrated database retrieval system