KEGG   Corynebacterium diphtheriae C7: CDC7B_0178Help
Entry
CDC7B_0178        CDS       T01699                                 

Gene name
tox
Definition
diphtheria toxin precursor (EC:2.4.2.36)
Orthology
K00776  
NAD-diphthamide ADP-ribosyltransferase [EC:2.4.2.36]
Organism
cds  Corynebacterium diphtheriae C7
Brite
Enzymes [BR:cds01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.36  NAD+---diphthamide ADP-ribosyltransferase
     CDC7B_0178 (tox)
Bacterial toxins [BR:cds02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Diphtheria toxin (DT)
    CDC7B_0178 (tox)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
168632..170314
Genome map
AA seq 560 aa AA seqDB search
MSRKLFASILIGALLGIGAPPSAHAGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGI
QKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALK
VDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQ
AKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKT
KIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAG
ANYAAWAVNVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIAL
SSLMVAQAIPLVGELVDIGFAAYNFVESIINLFQVVHNSYNRPAYSPGHKTQPFLHDGYA
VSWNTVEDSIIRTGFQGESGHDIKITAENTPLPIAGVLLPTIPGKLDVNKSKTHISVNGR
KIRMRCRAIDGDVTFCRPKSPVYVGNGVHANLHVAFHRSSSEKIHSNEISSDSIGVLGYQ
KTVDHTKVNSKLSLFFEIKS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaaaactgtttgcgtcaatcttaataggggcgctactggggataggggcccca
ccttcagcccatgcaggcgctgatgatgttgttgattcttctaaatcttttgtgatggaa
aacttttcttcgtaccacgggactaaacctggttatgtagattccattcaaaaaggtata
caaaagccaaaatctggtacacaaggaaattatgacgatgattggaaagggttttatagt
accgacaataaatacgacgctgcgggatactctgtagataatgaaaacccgctctctgga
aaagctggaggcgtggtcaaagtgacgtatccaggactgacgaaggttctcgcactaaaa
gtggataatgccgaaactattaagaaagagttaggtttaagtctcactgaaccgttgatg
gagcaagtcggaacggaagagtttatcaaaaggttcggtgatggtgcttcgcgtgtagtg
ctcagccttcccttcgctgaggggagttctagcgttgaatatattaataactgggaacag
gcgaaagcgttaagcgtagaacttgagattaattttgaaacccgtggaaaacgtggccaa
gatgcgatgtatgagtatatggctcaagcctgtgcaggaaatcgtgtcaggcgatcagta
ggtagctcattgtcatgcataaatcttgattgggatgtcataagggataaaactaagaca
aagatagagtctttgaaagagcatggccctatcaaaaataaaatgagcgaaagtcccaat
aaaacagtatctgaggaaaaagctaaacaatacctagaagaatttcatcaaacggcatta
gagcatcctgaattgtcagaacttaaaaccgttactgggaccaatcctgtattcgctggg
gctaactatgcggcgtgggcagtaaacgttgcgcaagttatcgatagcgaaacagctgat
aatttggaaaagacaactgctgctctttcgatacttcctggtatcggtagcgtaatgggc
attgcagacggtgccgttcaccacaatacagaagagatagtggcacaatcaatagcttta
tcgtctttaatggttgctcaagctattccattggtaggagagctagttgatattggtttc
gctgcatataattttgtagagagtattatcaatttatttcaagtagttcataattcgtat
aatcgtcccgcgtattctccggggcataaaacgcaaccatttcttcatgacgggtatgct
gtcagttggaacactgttgaagattcgataatccgaactggttttcaaggggagagtggg
cacgacataaaaattactgctgaaaataccccgcttccaatcgcgggtgtcctactaccg
actattcctggaaagctggacgttaataagtccaagactcatatttccgtaaatggtcgg
aaaataaggatgcgttgcagagctatagacggtgatgtaactttttgtcgccctaaatct
cctgtttatgttggtaatggtgtgcatgcgaatcttcacgtggcatttcacagaagcagc
tcggagaaaattcattctaatgaaatttcgtcggattccataggcgttcttgggtaccag
aaaacagtagatcacaccaaggttaattctaagctatcgctattttttgaaatcaaaagc
tga

DBGET integrated database retrieval system