KEGG   Corynebacterium diphtheriae C7: CDC7B_0348Help
Entry
CDC7B_0348        CDS       T01699                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDC7B_0348 (hemB)
Enzymes [BR:cds01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CDC7B_0348 (hemB)
Exosome [BR:cds04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDC7B_0348 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
351012..352004
Genome map
AA seq 330 aa AA seqDB search
MNLDLIRRPRRLRSTPVMREFVAETTLRPADLILPMFIADGIDKPREIESMPGVCQHTME
SLIEAVREAISVGIRCVDLFGVPLDSDKDATGSQAWDPEGILNRGVRALRQEFGDQVLIT
ADTCLDEFTDHGHCGILTTDRFGATIVDNDPTVELYQKMAVAQAEAGAHIVSPSGMMDGQ
ILAIREALDAAGFHDVAIMAYSAKYASAFYGPFRDAVGSSLQGDRRAYQQDPANLRESIL
EVDLDIEEGADFVMVKPAMPYLDVLAEVASTSSVPVAAYQVSGEYAMLHAAAANGWLDLD
RVMMESLISIKRAGADQILTYFAVEAARKL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatctagatcttattcgtcgtcctcgtcggttgcgttcgactccggtgatgcgtgaa
ttcgttgcggaaaccacgctgcgtccggctgatcttattttgccgatgtttattgccgat
ggcattgataagcctcgggagattgagtcgatgccaggtgtgtgccagcacaccatggaa
tcccttatagaggctgtccgtgaggcgatctcggtgggtattcgctgcgtggatcttttc
ggtgtgccactggattccgataaggatgccactggttcacaagcgtgggatcccgagggc
attttgaaccgcggtgtgcgtgcgcttcgtcaggagttcggtgatcaggtgctcatcacg
gcggatacctgccttgacgagttcaccgatcatgggcactgtggcattttgaccacggat
cgctttggcgccaccattgtggataacgatccaacggttgagttgtatcagaagatggcg
gttgctcaggctgaagcgggtgctcatattgtgagcccgtcgggcatgatggacggccag
attttagctatccgtgaggctctcgacgccgcagggttccacgatgttgcgatcatggcg
tattccgctaaatatgcgtcggcgttttatggtcctttccgtgacgcagtgggctcctct
ttgcagggtgatcgtcgtgcctaccagcaagatcctgctaatctccgtgagtcgatcctc
gaagtcgatctggacattgaggaaggcgcggattttgttatggtcaaacctgctatgccg
tacttggatgtgcttgctgaggtagcgtctacgtcgtcggttccggtggcggcttaccag
gtttctggcgagtatgcgatgttgcatgcggctgctgcgaacggctggttggatctggat
cgggtgatgatggagtctctgatttctattaaacgtgccggtgcggatcaaatcctgaca
tactttgctgtagaagcagcacgaaaactttaa

DBGET integrated database retrieval system