KEGG   Corynebacterium diphtheriae C7: CDC7B_0732Help
Entry
CDC7B_0732        CDS       T01699                                 

Gene name
echA2
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CDC7B_0732 (echA2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CDC7B_0732 (echA2)
   00650 Butanoate metabolism
    CDC7B_0732 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CDC7B_0732 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDC7B_0732 (echA2)
   00310 Lysine degradation
    CDC7B_0732 (echA2)
   00360 Phenylalanine metabolism
    CDC7B_0732 (echA2)
   00380 Tryptophan metabolism
    CDC7B_0732 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDC7B_0732 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDC7B_0732 (echA2)
   00281 Geraniol degradation
    CDC7B_0732 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDC7B_0732 (echA2)
   00627 Aminobenzoate degradation
    CDC7B_0732 (echA2)
   00930 Caprolactam degradation
    CDC7B_0732 (echA2)
Enzymes [BR:cds01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CDC7B_0732 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
743924..744700
Genome map
AA seq 258 aa AA seqDB search
MAQVEVRIDGHLMCVTVNRHEARNALSAQMCDDITSALNNADEQARDTAAIRAVLIRSVG
TIFCAGADLGSTTQSDDAAEVTQSDFHDSLTRMLESVVSCGVPVIADIQGPAVGAGMQLA
LSCDLRLVHHAAWFKVPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVAT
GFALEIADSDSAIAYAHRIAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDA
REGQLARKQKRDPVFTGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaggtagaggtgcgtatcgacggccacctgatgtgtgtcaccgtaaatagacac
gaggctcgcaacgcactttctgcacagatgtgcgatgatattacatctgctcttaataat
gcagatgagcaggcgcgtgacactgcagctattcgcgccgtgctcatccgttctgttggt
acgatcttttgtgccggagcagatttgggcagtaccacccaaagtgatgatgcggctgag
gtaacgcagtcggatttccatgactctcttacgcgcatgttggaatcggttgtttcctgt
ggagtcccagttattgctgatattcaaggaccagctgttggcgctggcatgcagctggca
ttgagctgcgacctgcgtttggttcatcatgctgcatggtttaaggtgccggcggcgtct
cttgggttcgcgctcgacggatggactattaatagggcacagtgtttgctgggcggtggt
tgggcgcgatcaattttcttgggcggcgcaacgctatcggcaccgcaggcggtggcaact
ggttttgcgctggagatcgctgattccgattctgcgattgcctatgctcatcgtattgct
ggaatggcacccttggcgctgcggcaacttaaatccgcgctcaacagtgctgattttgaa
tatgcgcttgttggggaatctcgtgatctttttgcccaatgttgggctagtacggatgct
cgcgaagggcagctggctcgaaaacaaaagcgagatccggtgtttactggtcgctga

DBGET integrated database retrieval system