KEGG   Corynebacterium diphtheriae C7: CDC7B_0732Help
Entry
CDC7B_0732        CDS       T01699                                 

Gene name
echA2
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cds01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cds00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cds00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cds00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:cds00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cds00310]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:cds00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:cds00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cds00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:cds00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:cds00362]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cds00627]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
743924..744700
Genome map
AA seq 258 aa AA seqDB search
MAQVEVRIDGHLMCVTVNRHEARNALSAQMCDDITSALNNADEQARDTAAIRAVLIRSVG
TIFCAGADLGSTTQSDDAAEVTQSDFHDSLTRMLESVVSCGVPVIADIQGPAVGAGMQLA
LSCDLRLVHHAAWFKVPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVAT
GFALEIADSDSAIAYAHRIAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDA
REGQLARKQKRDPVFTGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaggtagaggtgcgtatcgacggccacctgatgtgtgtcaccgtaaatagacac
gaggctcgcaacgcactttctgcacagatgtgcgatgatattacatctgctcttaataat
gcagatgagcaggcgcgtgacactgcagctattcgcgccgtgctcatccgttctgttggt
acgatcttttgtgccggagcagatttgggcagtaccacccaaagtgatgatgcggctgag
gtaacgcagtcggatttccatgactctcttacgcgcatgttggaatcggttgtttcctgt
ggagtcccagttattgctgatattcaaggaccagctgttggcgctggcatgcagctggca
ttgagctgcgacctgcgtttggttcatcatgctgcatggtttaaggtgccggcggcgtct
cttgggttcgcgctcgacggatggactattaatagggcacagtgtttgctgggcggtggt
tgggcgcgatcaattttcttgggcggcgcaacgctatcggcaccgcaggcggtggcaact
ggttttgcgctggagatcgctgattccgattctgcgattgcctatgctcatcgtattgct
ggaatggcacccttggcgctgcggcaacttaaatccgcgctcaacagtgctgattttgaa
tatgcgcttgttggggaatctcgtgatctttttgcccaatgttgggctagtacggatgct
cgcgaagggcagctggctcgaaaacaaaagcgagatccggtgtttactggtcgctga

DBGET integrated database retrieval system