KEGG   Corynebacterium diphtheriae C7: CDC7B_1302Help
Entry
CDC7B_1302        CDS       T01699                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDC7B_1302 (tpi)
   01230 Biosynthesis of amino acids
    CDC7B_1302 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDC7B_1302 (tpi)
   00051 Fructose and mannose metabolism
    CDC7B_1302 (tpi)
   00562 Inositol phosphate metabolism
    CDC7B_1302 (tpi)
Enzymes [BR:cds01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CDC7B_1302 (tpi)
Exosome [BR:cds04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CDC7B_1302 (tpi)
  Exosomal proteins of bladder cancer cells
   CDC7B_1302 (tpi)
  Exosomal proteins of melanoma cells
   CDC7B_1302 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1337689..1338471)
Genome map
AA seq 260 aa AA seqDB search
MARTPLIAGNWKMNLDHLQAVATVQKLAFALPKEYYEKVDVAVTVPFTDLRSVQTLIEGD
KLAITYGAQDVSQHEAGAYTGEISAQMLAKLGCTWVVVGHSERREYHGESSELVAVKAKA
ALNQGISPIVCVGEPLEIREAETHVEYVVEQTRASLAGLTADDLAKTVIAYEPVWAIGTG
KVASAADAQEVCAAIRNLIIELAGKEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATVVD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtactccacttatcgcaggaaactggaagatgaatcttgatcatcttcaagct
gttgcaactgtgcaaaaacttgcttttgcacttccaaaggaatactacgaaaaagtcgac
gtagctgtcaccgtaccttttactgatcttcgctctgttcaaacacttatcgaaggcgat
aagctcgctataacttatggtgctcaagatgtttcgcagcacgaggctggtgcctacact
ggtgaaatctctgcccagatgcttgccaaactcggatgtacttgggttgttgttgggcac
tcagagcgtcgtgagtaccatggcgaatcttcggagcttgttgcagtcaaagctaaagct
gcgttgaaccaaggaattagccccatcgtatgtgttggagagccccttgaaattcgtgaa
gctgaaacacacgtagaatatgtcgtcgaacagactcgcgcatcgttggcgggtcttact
gcagatgatttggcaaagactgttatcgcctacgaacccgtatgggctattggtacgggt
aaagtagcatccgctgccgatgcacaggaagtctgcgcagcaattcgtaacctcatcatt
gagcttgctggtaaagaagtagctgaagggcttcgcattctttatggcggatcagttaaa
gcagaaacagtagccgagatcgtaggtcaaccggatgttgatggcggcttagtgggtggc
gcttctcttgacggtgaagcattcgccaaactagcagctaatgcagcaactgttgtcgac
tag

DBGET integrated database retrieval system