KEGG   Corynebacterium diphtheriae C7: CDC7B_1408Help
Entry
CDC7B_1408        CDS       T01699                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00010  Glycolysis / Gluconeogenesis
cds00520  Amino sugar and nucleotide sugar metabolism
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
cds01120  Microbial metabolism in diverse environments
cds01130  Biosynthesis of antibiotics
cds01200  Carbon metabolism
Module
cds_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDC7B_1408 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    CDC7B_1408 (ppgK)
Enzymes [BR:cds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CDC7B_1408 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEX67604
Position
1452002..1452763
Genome map
AA seq 253 aa AA seqDB search
MIRMENIGFGIDVGGSGIKGARVNLDTGEFVGDRIKILTPKPATPDAVAETIKRILDQAE
WEGPVGITLPSVIHEQRALTAANIDPSWIDVDVNELFARHLGDTEVSVLNDADAAGLAEA
QFGDPIAREGSVILLTFGTGIGSAFLVNGTLFPNTELGHMLVDGEEAEKIASSAAKDRDE
IGYGKWAKRVSKVLNEYERLFWPSAFIVGGGISRKAEKWVPRLTVNTKVVPAQLRNTAGI
VGAAMAASQNLHP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcatggaaaacatcggattcggtatcgacgttggcggctctggtatcaaggga
gcgcgcgtgaatctagacacaggagaatttgtaggagatcgtatcaagattcttactcct
aaacctgcaacccccgatgcagtcgccgaaacaatcaaacgcatcctcgatcaagccgaa
tgggaagggcctgtcggcattactctaccttccgtcattcacgaacaacgagccctcacc
gccgccaatatcgacccatcgtggattgatgtagacgtaaatgagctatttgctcggcac
ttaggcgacaccgaagtttcggttctcaatgacgccgacgctgcgggattggcagaagcc
caatttggcgatcccattgcacgtgaaggaagtgtaatccttctaacctttggtacaggt
ataggttcagcattcttagtcaacggtacgttgtttcccaacactgaactgggccacatg
cttgtagatggcgaagaagcagaaaaaatcgcatcgtctgcagccaaagatcgcgatgaa
attggatacggaaagtgggctaagcgcgtatcgaaggtgctcaacgaatatgagcggctc
ttttggccatcagcttttatcgtcggtggtggcatctcccgtaaagctgaaaagtgggta
cctcgtctcaccgttaacaccaaggttgtcccagcccagctaagaaacaccgctggaatc
gtaggagctgccatggcagcatcccaaaatcttcacccctaa

DBGET integrated database retrieval system