KEGG   Corynebacterium diphtheriae C7: CDC7B_1502Help
Entry
CDC7B_1502        CDS       T01699                                 

Gene name
ispC
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00900  Terpenoid backbone biosynthesis
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
cds01130  Biosynthesis of antibiotics
Module
cds_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDC7B_1502 (ispC)
Enzymes [BR:cds01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CDC7B_1502 (ispC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Sacchrp_dh_NADP DapB_N
Motif
Other DBs
NCBI-ProteinID: AEX67695
Position
complement(1554699..1555862)
Genome map
AA seq 387 aa AA seqDB search
MRKKILILGSTGSIGTQALEVIASRQDQFEVVGIAAGGREPQLIIQQAQMLGLAADHVAV
ANEKSATQVSRALGAAVLSGTDAATDLVESVPADTVLNGLVGSMGLRATLATIQLGEVLA
LANKESLVAGGTFVTSQAAPGQIVPVDSEHSAMAQCLRSGASSEVSKLVLTASGGPFRGW
TREEMWDVTPEQAAAHPTWSMGQMNTLNSATLINKGLELIEATLLFDIPADRIEVTVHPQ
SIVHSMVTFCDGATIAQASPPSMLLSISHALAWPHRVPEAQPALDFSQASTWDFMPVDNE
AFSAVELAREVALKQGTYPAVYNAANEQAAAAFLRGRIRFPQIVDIVGEVVAGSSQFAGV
ASSVEEIIAHESESRRRADALVDKLSR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaagaaaatcttgattctgggcagcactggttccatcggcactcaggcgcttgag
gttatagcttcgcgccaagaccaatttgaggtggtaggtattgccgcgggtggccgagag
ccacaattaattatccagcaagcccagatgctgggtttggcggcagaccatgttgctgtg
gccaatgagaaatcggcaactcaagtcagtcgtgcacttggggcagcggtattaagtgga
actgatgccgctaccgacctcgttgagtcggtgccagcggatacggtacttaatggcctt
gtgggttccatggggctacgggccaccttggctacgattcaactaggtgaagttctggcc
ttagctaataaggaatcgttggttgccggtggtacgtttgttacatctcaggcagccccg
gggcagatcgtgcctgtggattccgagcattctgcgatggcgcagtgtttgcgatcaggg
gcatcatcggaagtgtcaaagttggttctgactgcttcaggtggcccattccgcggctgg
acacgggaggagatgtgggatgttactcctgagcaagctgcggcacatccaacgtggtcg
atggggcagatgaatacattgaattcggctactttgataaataaaggattggagttaatt
gaggcaactttgctctttgacatcccagctgaccgtattgaggtgactgttcatccgcag
tcgattgttcattcgatggtcacgttttgtgatggtgcaacaattgctcaagcatcgcca
ccatccatgttgctgtcaatttctcatgccttggcatggcctcaccgagttccagaggcg
caaccggctttggatttctctcaagcaagtacgtgggatttcatgccagtagataatgag
gctttctccgcagttgagttagcgcgcgaggtggctttgaaacagggaacgtatccagca
gtgtataacgcggcaaacgagcaggcggccgctgcgtttcttcgtgggcgcattaggttc
ccgcagattgtcgatattgtcggcgaagtggtggcaggatcttcacagtttgctggtgta
gcctcatcggtcgaagaaattattgcgcacgaaagtgagtcgcgtagacgagcagacgcg
ctcgtcgataagctttctcgctga

DBGET integrated database retrieval system