KEGG   Corynebacterium diphtheriae C7: CDC7B_1553Help
Entry
CDC7B_1553        CDS       T01699                                 

Gene name
trpC2
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
cds01130  Biosynthesis of antibiotics
cds01230  Biosynthesis of amino acids
Module
cds_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDC7B_1553 (trpC2)
Enzymes [BR:cds01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CDC7B_1553 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh QRPTase_C OMPdecase PDZ
Motif
Other DBs
NCBI-ProteinID: AEX67746
Position
complement(1612818..1613624)
Genome map
AA seq 268 aa AA seqDB search
MVTVFDEIIAGVVEDVAAREAQVSFQDIKAQSRLCAPPRDACGALLASGCGIIAEIKRAA
PGQGLLAEIPSPVDLALELESGGAALIACHTERRRFHGSLTEMAKIRRHVSVPVMCRDFI
VDPYQIHEARCYGADMVPLRVAALAQSRLVALIDRVESLGMAALVEVRDTAEASRALDAG
ARIIGVNARDFSTMTLNRAAFCEIAPGLPSDVVRVALSGVRNAKELLDYASAGADAVVIG
QSIVTAQSPRGATRALVAAGQHPSCPSR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggttacagtcttcgatgagatcatcgctggtgttgtggaagacgttgccgcgcgcgaa
gcgcaggtttcattccaggacatcaaagcgcagtctcgtctgtgcgcgccacctagggat
gcttgtggggcattgttagcaagtggctgtggaatcatcgcggagatcaaaagggcagca
cctggccaaggtttgcttgcggagattccttcgccggtagatctggctcttgagctcgag
tccggcggtgcggcgttgattgcttgtcacacagagcgccggcggtttcatgggtctttg
acggagatggcgaagattcgtcgtcacgtgtccgttccagttatgtgtcgcgattttatt
gttgatccctatcagattcatgaagctcgctgctatggagctgatatggtgccgcttcgg
gtagctgcgcttgcgcagtcacgacttgttgcattgattgatcgggtggagtccctgggg
atggctgcgcttgtcgaggtacgtgatactgcggaggcatctcgtgccttagatgctggt
gctcgaattatcggtgttaatgcgagagatttttctacgatgacccttaaccgagcggct
ttttgtgagatcgctccaggacttcctagcgacgtggtccgagtggcgctttcaggggtt
cgtaatgctaaagagcttttagactacgcctcggctggggcagacgccgtggtgattggt
caaagcatcgtgacggcgcaatcgcctcgaggggcgacgcgtgccttggttgctgcaggc
cagcatccctcgtgtccctcacgttag

DBGET integrated database retrieval system