KEGG   Corynebacterium diphtheriae C7: CDC7B_1636Help
Entry
CDC7B_1636        CDS       T01699                                 

Gene name
sucB
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cds01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cds00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cds00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1703404..1705020
Genome map
AA seq 538 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDTVTADEPLLEVSTDKVDTEVPSPVSGVLLEIK
FEEDDTVDVGDVIAIIGEEGDAPAAKEEQKVEEPQAEAPKAEAADSTDVVMPELGESVTE
GTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVIVRV
GTPGSAPAAKEEPAKEPKAETPKEEPKAEAPKAEPKKEAPAKTINNENVPYVTPLVRKLA
DKHGVDLTTVEGTGIGGRIRKQDVLAAAGVGAAPAAQVAPAQPVSAASTKSVDPEKQKLI
GTTQKVNRIREITARKTVEALQISAQLTQLHEVDMTKVAELRKANKPAFQEKHGVNLTYL
PFFAKAIVEALVAHPNVNASYNAETKEMTYHADVNLSIAVDTPAGLLTPVIHKAQELSLP
ELAKAIVDLADRARNNKLKPNDLSGGTFTITNIGSEGALSDTPILVPPQAGILGTGAIVK
RPVVITEDGIDSIAIRQMVYLPLSYDHQIVDGADAGRFLTTIKDRLETANFEGDLELS
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgtaatgcctgaactgggcgaatccgtcaccgaaggtaccatcacc
cagtggctgaagtccgttggtgacacggtcactgccgacgagccgttgctcgaggtatct
actgacaaggtcgacactgaagttccttcgcctgtctccggtgtcttgcttgagatcaag
tttgaggaagatgacaccgtagacgtcggagacgttattgcgattattggcgaagaaggc
gacgctccagctgccaaggaagagcaaaaagtcgaggagccacaagctgaggcaccaaag
gctgaagcagctgactccaccgacgtagtcatgcctgaactcggcgagtccgtcaccgaa
ggcaccatcacccagtggctgaagtccgttggcgacaccgtcgacgttgacgaaccactc
ctcgaagtctccaccgacaaggtcgacaccgaagtcccatccccagtcgctggcaccatc
ctcgaaatcctcttcaacgaagacgacaccgtcgacgtcggagacgtaatcgttcgcgtt
ggcaccccaggatctgctccagcagccaaggaagagccagccaaggagccaaaagccgag
acaccaaaggaagagccaaaagctgaggcaccaaaggctgagccaaagaaggaagctcct
gccaagaccatcaacaacgagaacgtcccttacgtcactccgctggtccgcaagctggct
gacaagcacggcgttgatctgaccactgttgaaggcactggtattggtggacgcatccgc
aaacaggatgttttggctgctgctggcgttggcgcagcccctgcagcacaggttgctcct
gcccagccagtttctgcagcatccaccaagtccgtggatccagagaagcagaagctgatc
ggtacaactcagaaggtcaaccgtatccgagagatcaccgcgcgcaagactgtggaggct
ttgcagatttctgctcagctcacccagctgcatgaggtcgatatgactaaggttgcggaa
ctgcgtaaggccaacaagccagccttccaagaaaagcacggtgtgaacctcacctacttg
ccattctttgcaaaggcaattgttgaggctttggttgctcacccgaacgtcaatgcgtcc
tacaacgctgagacaaaggagatgacctaccacgctgatgtcaacctctccatcgccgtt
gataccccagctggtctgcttacccctgttatccacaaggctcaggagttgtccttgcct
gagctcgctaaggcaattgtcgatttggctgaccgtgctcgtaacaacaagctcaagccg
aatgatctttccggtggcaccttcaccattaccaacattggttctgagggcgctctcagc
gataccccaatcttggttccaccacaggcaggtatcttgggtaccggcgctattgttaag
cgtccagtagtcatcacggaagatggcatcgattcgattgctattcgccagatggtctac
ttgccacttagctacgatcaccagatcgtcgatggtgccgatgcaggtcgtttcttgacc
accatcaaggatcgccttgagactgcaaacttcgaaggcgacctcgaactctcctag

DBGET integrated database retrieval system