KEGG   Corynebacterium diphtheriae C7: CDC7B_1649Help
Entry
CDC7B_1649        CDS       T01699                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDC7B_1649 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDC7B_1649 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CDC7B_1649 (thrC)
Enzymes [BR:cds01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CDC7B_1649 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1715972..1717420)
Genome map
AA seq 482 aa AA seqDB search
MKYISTRDASSTPARFTDILLGGLAPDGGLYLPEQYPQLTEELLEQWRTLLEDKGYAALA
AEVLKLFIDDIPAADIEKITARAYTTPKFSDEDIVPVTKLENNIYIGHLSEGPTAAFKDM
AMQLLGELFEYELERRGESLNILGATSGDTGSSAEYAMRGRKGIRVFMLTPAGRMTPFQQ
AQMFGLDDSNIFNIALDGVFDDCQDVVKAVSGDSEFKKNYRIGAVNSINWARLVAQVVYY
ISSWLRVTDSNDQKVSFCVPTGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFRTG
DYRVRSSADTYETSSPSMDISRASNFERFIFDLLGRDAGRVADLFGTQVKQGGFSLAQDP
AFAEAANRYGFASGKSTHADRVATIADCYENRGMMIDPHTADGVKVARDWACDIDSPIVC
LETALPVKFADTICEATGREPEMPERFANIMDAQRRVTDLPNDVAVVKDFIVTSIEETEK
TQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatttcaacgcgcgacgcatcatcgactccggctcgatttaccgatatcttg
cttggtggacttgcccccgatggcggcctttacctgccggaacagtatccacaactgacc
gaagagctgcttgagcagtggcgtacgttgttagaagacaaaggatatgcggcactcgca
gctgaagtattaaagctatttatcgacgacatccctgcggccgatattgaaaaaatcacc
gcccgtgcgtacaccacgccaaaattttccgacgaggacatcgttccagtgaccaagctg
gagaacaacatttatatcggtcatctttcagaaggcccaacggcggcatttaaagacatg
gctatgcagttgctcggcgaacttttcgaatatgagctagagcgtcgcggcgaatccctg
aatatcctcggtgcaacctccggtgacaccggatcgtctgcggaatacgccatgcgtggc
cgaaaggggatccgcgtttttatgctcacccctgcggggcgtatgaccccattccagcag
gcacagatgttcggtcttgatgactcaaatatctttaatatcgcgctcgatggtgtattc
gacgattgccaagatgtagttaaagcagtgtcgggggattcggaatttaaaaagaactac
cgaatcggagcagtgaactccattaactgggcacgtcttgtagcacaagttgtgtattac
atttcttcttggcttcgcgttaccgatagcaacgaccaaaaagtgagcttttgtgtacca
accggcaacttcggtgacatctgcgcagggcatattgcaaaacagatgggtcttcctatc
gatcgccttatcgttgcaacgaatgaaaatgatgtactcgatgagtttttccgcaccggc
gattaccgtgtacgcagttctgcagatacgtatgaaacatcctctccgtccatggacatt
tcgcgcgcttctaactttgaacgctttatatttgatcttctcggacgagatgcaggcaga
gtagctgatctatttggtacccaagtcaagcagggtggattcagcttggctcaggaccca
gcattcgccgaggccgcgaatcgttacggatttgcctccggtaaatctacccatgctgat
cgtgttgccacgattgcagactgctacgaaaatcgtggcatgatgatcgaccctcatacc
gcggacggtgtgaaagtagcacgagattgggcctgcgatattgattcgccaattgtctgc
cttgaaactgcgcttccagttaagttcgctgacactatctgcgaggcaacaggacgcgaa
cctgagatgccagagcgctttgccaacatcatggatgctcaacggcgtgtaactgatctt
cctaatgacgtagcagtggtcaaagacttcattgtgactagcatcgaggaaaccgaaaaa
actcagtag

DBGET integrated database retrieval system