KEGG   Corynebacterium diphtheriae C7: CDC7B_1686Help
Entry
CDC7B_1686        CDS       T01699                                 

Gene name
dgt
Definition
deoxyguanosinetriphosphate triphosphohydrolase
Orthology
K01129  
dGTPase [EC:3.1.5.1]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
Purine metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cds00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1755726..1756997)
Genome map
AA seq 423 aa AA seqDB search
MFSYSSSDWQRRFDEPEKPSRIIAHHDERGPFAKDRARVLHSAALRRLADKTQVVGPRDG
DTPRTRLTHSLEVAQIARGIGTGLGLDADLCEMAGLTHDIGHPPYGHNGEKALAEIAQDC
GGFEGNAQTLRILSKLEPKIVDDHDQSYGLNLTRAALDAACKYPRTKTNPDGSVNKKYGC
YDEDAHILQWVRQGHEDTSACVEAQAMDFSDDIAYSVHDVEDGIVSGRVHLGVLWDFVEL
AELAEKGARAFGGTPEALVDAADHLRELPIISAAADFDGSLRGYVDLKAMTSQLVGRYVG
AVIEASRAANPTGVFGRSTGQVVVPDQVLAEVTLLKTIAVLYVMDDPAHLQRQDRQRERI
YRVYDYLVAGGRGALDPMFRLWWEQAESEAQRQRVIIDNISSMTESRLERVAKQSAELSS
FMG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtttagctattcctcttctgattggcagcggcgtttcgacgaacccgaaaagcccagc
cgaatcattgcacatcacgatgaacgaggtccttttgccaaggatcgcgctcgggtattg
cattcggcagccttgcgtcggctagctgataagactcaggtagtaggaccacgtgacgga
gataccccgcggactcgattgacgcactcactcgaagttgcgcaaattgcgcgcgggatt
ggtacggggcttggccttgatgccgatctatgcgaaatggctgggttgacacacgatatt
ggccatccgccctatgggcacaatggtgaaaaagccttggcggaaattgctcaagattgt
ggtgggttcgaaggaaacgcccaaacgctgcgtattttgagcaaacttgagcccaaaatc
gttgatgaccacgatcagtcctacggtcttaacctcacgcgtgctgcccttgatgctgcg
tgtaagtatccgcggaccaaaactaatcctgatggcagcgtgaataaaaaatatggctgt
tatgacgaagacgcccatattttgcagtgggtgcgtcaaggccacgaggacacttcggcg
tgtgtggaagcccaagcaatggatttttccgatgacatcgcctactccgttcacgatgtc
gaagatgggatcgtgtcggggcgagtacaccttggggtgctatgggattttgttgagctt
gcagagcttgcagaaaaaggtgcacgagcttttggcggtactccagaagcgcttgtcgac
gccgctgaccatcttcgtgaactaccgatcatttctgctgctgctgatttcgacggatca
ctgcgtggctatgttgaccttaaagccatgacatcccaattagttggccgatatgtgggt
gcggttatcgaagcatcgcgggcagcgaacccgacaggggtgtttggacgttccacagga
caagtagttgttccagatcaagtgctggctgaagtcaccctgctcaaaactattgccgtc
ttatatgtcatggatgatcccgcacatctccagcgccaagatcgccagcgtgagcgtatc
taccgtgtgtatgactacctcgtagccggcggtagaggagcattagatcccatgttccgc
ctgtggtgggaacaagcagaatctgaagctcagcgccagcgagtcatcatcgacaatatt
tcttcgatgacagaatcacgcttggaacgcgtcgcaaagcaatctgccgagctcagcagc
tttatggggtga

DBGET integrated database retrieval system