KEGG   Corynebacterium diphtheriae C7: CDC7B_1896Help
Entry
CDC7B_1896        CDS       T01699                                 

Gene name
gpx
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00480  Glutathione metabolism
cds00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CDC7B_1896 (gpx)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CDC7B_1896 (gpx)
Enzymes [BR:cds01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CDC7B_1896 (gpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AEX68087
Position
complement(1983577..1984119)
Genome map
AA seq 180 aa AA seqDB search
MRSGSKPRLNTLGCAIKQPERNPRMSIFDTEVTLINGEKASMDQWAGHCLLIVNTASECG
YTPQLETLEELYEDYAMRGFFVIGVPCNQFGEEEPGKDAQVARRYEEKFGVRFPLLAKSD
VNGPNTIELYKKLKGDGPDIEWNFEKFIVAPSGEVVGRFAPSLNPDDMKIINVLEEYLPI
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtggaagcaaaccgcgtttgaatacgcttggctgtgccatcaagcaaccggaa
aggaatcctaggatgagtatttttgataccgaggtcacgctgatcaacggcgagaaagcc
tcaatggatcagtgggctggtcattgcctgttgattgtgaatacggcatcagagtgcggc
tataccccgcagctggagacgctggaagagctttatgaggattatgcgatgcgtggtttc
ttcgtgatcggtgttccgtgtaaccagttcggggaggaagaacctggcaaggatgctcag
gtggcgcgtcgatacgaagaaaagtttggggtgcgcttcccgctgttggctaagtcggac
gtcaatggccccaacactattgagctgtataagaagctcaagggtgatggtccagatatt
gagtggaactttgaaaagtttatcgtagcgcccagcggtgaggtggtaggccgctttgcg
ccctcgcttaatcctgacgatatgaagatcattaacgtcttagaagagtatcttcctatc
taa

DBGET integrated database retrieval system