KEGG   Corynebacterium diphtheriae C7: CDC7B_2086Help
Entry
CDC7B_2086        CDS       T01699                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CDC7B_2086 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDC7B_2086 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CDC7B_2086 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CDC7B_2086 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CDC7B_2086 (adhA)
   00626 Naphthalene degradation
    CDC7B_2086 (adhA)
Enzymes [BR:cds01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CDC7B_2086 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2186111..2187151)
Genome map
AA seq 346 aa AA seqDB search
MSATEFPSAFTAAVVDKFGSELNIHDVDLPEPGQHQALVKVLTSGICHTDLHAAEGDWPV
KPKPPFVPGHEGVGEVVKLGPGEHSVALGDMVGNVWLWSACGECEYCRTGWETMCEKAEY
GGYTVDGSFGQYMLVDTRYCARIPDGCDLLEVAPILCAGVTVYKGLKVTETRPGQFVVIS
GVGGLGHIAVQYAVAMGMRVIAVDIADDKLELAKKHGAEFVVNAREEDPAEAIVKYTKGG
AHGVLVTAVHPQAFGQAIGMARKNGTIVFNGLPPGEFPAPIFDIVFKGLTIRGSLVGTRQ
DLEEALDFYARGMIKPTVTECKLDDVNSVFADMKQGKIDGRMAIRY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgaattcccctctgccttcaccgccgctgttgtggacaagtttggctcc
gagctcaacattcacgacgttgacctcccagagccaggccaacaccaagcactggtcaag
gtgctcacctccggtatctgccacactgacctccacgccgccgaaggcgactggccagtt
aagccaaagccaccattcgtcccaggccatgagggcgtaggcgaagtggtcaaacttggc
ccaggtgagcacagtgttgcgctgggtgacatggtcggtaacgtctggctctggtcagcc
tgtggcgagtgcgagtactgtcgcaccggctgggagactatgtgcgagaaagccgagtac
ggtggatacaccgtcgatggttccttcggtcagtacatgctggtagacacccgttactgt
gcccgaatcccagacggctgtgacttgctggaagtcgccccaattctgtgcgctggcgtg
accgtgtacaaaggcctcaaggttaccgaaacccgcccaggccagttcgtggtcatctct
ggcgtgggtggtctgggccatatcgccgtccagtacgccgtggctatgggcatgcgcgtt
atcgccgtggatattgcggacgacaagctcgaactggctaagaagcatggcgctgagttt
gtggtcaatgcccgcgaagaagacccagctgaggcaattgtgaagtacaccaagggtggc
gcacatggcgtgctggtcaccgcggtgcaccctcaggccttcggtcaggcaattggcatg
gctcgtaagaacggaaccattgtgttcaatggtcttcctccaggagagttcccagcaccg
atcttcgacatcgttttcaagggcctgaccatccgcggctccctcgtaggtacgcgccaa
gaccttgaagaggctttggacttctacgctcgcggcatgatcaagccaacggttactgaa
tgcaagcttgacgacgtcaactcggtctttgctgatatgaagcaaggcaagatcgacggc
cgcatggctatccgctactag

DBGET integrated database retrieval system