KEGG   Corynebacterium diphtheriae C7: CDC7B_2109Help
Entry
CDC7B_2109        CDS       T01699                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDC7B_2109 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    CDC7B_2109 (fadA)
   00640 Propanoate metabolism
    CDC7B_2109 (fadA)
   00650 Butanoate metabolism
    CDC7B_2109 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    CDC7B_2109 (fadA)
   00072 Synthesis and degradation of ketone bodies
    CDC7B_2109 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDC7B_2109 (fadA)
   00310 Lysine degradation
    CDC7B_2109 (fadA)
   00380 Tryptophan metabolism
    CDC7B_2109 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDC7B_2109 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDC7B_2109 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CDC7B_2109 (fadA)
Enzymes [BR:cds01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDC7B_2109 (fadA)
Exosome [BR:cds04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDC7B_2109 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2218623..2219531)
Genome map
AA seq 302 aa AA seqDB search
MMGEQGSFDAVALKKYPQLETINHVHHAGNSSGIVDGAALTLIGSEKAGADMGLIPRARI
VVTAVNGVEPAVREALAKANLTVDDIDVWEINEAFAAVVKHAQQNLGIDYEKLNIKGGAM
AMGHPLGATGAMITGAAIDELHRISGRYGLISLCVAGGESGITGIIITPAKKTFFAGGDI
KQMSKATEADAEAMFTMVEHMKESLRLEKLPVPIVAVINGAALGGGLEVALAANHRIAAD
ARGSKIGLPEVTLALLPGGGGVSRVVRMIGIQNALMQVILTGAQMNPQPPSGTTPHVAGP
PH
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtgagcagggcagcttcgacgctgttgcactgaagaaatacccacagcttgag
accatcaaccacgtccaccacgccggtaattcttccggcattgtcgacggcgctgccctg
actctcatcggttccgagaaggcaggcgcggatatgggactgatcccacgcgcacgcatc
gtcgtcaccgccgtcaacggtgtcgagccagctgttcgcgaagcactcgcgaaagcaaac
ctgactgtcgatgacattgatgtctgggagattaacgaggctttcgcagccgtcgtgaag
catgcacagcagaacctgggcattgactacgaaaagctcaacatcaaaggtggcgctatg
gcaatgggccacccactgggtgcgaccggcgcgatgatcaccggcgctgctatcgacgaa
ctgcaccgcatcagcggacgctacggccttatctcgctgtgcgtcgctggcggggaatcc
ggtatcacgggcattatcatcacccccgcgaaaaagaccttcttcgcaggtggcgacatc
aagcagatgtccaaggccaccgaggccgacgcggaagccatgttcaccatggttgagcac
atgaaggagtccctccgcttggagaaactaccggttccaatcgtggcagtcatcaacggt
gcagctctcggcggcggtctcgaggtcgctctcgcagctaaccaccgcattgccgccgat
gcccgcggctccaagatcggcctgccagaggtcaccctcgcccttttgccaggcggcggc
ggtgtctcccgcgtcgttcgcatgattggtattcagaatgcactgatgcaggtcatcctc
accggcgcacagatgaatccgcagccgccaagtggcacgacgccgcacgtggccgggccg
ccgcactag

DBGET integrated database retrieval system