KEGG   Corynebacterium diphtheriae C7: CDC7B_2150Help
Entry
CDC7B_2150        CDS       T01699                                 

Definition
putative secreted glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cds00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cds00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2261948..2263099)
Genome map
AA seq 383 aa AA seqDB search
MDNLRRVFTPASLILGTVVAASMLSSCSQDSSQQAAPSTPSSTPTASQSEQLSSASSTPQ
AVALDPVQLRKDAASLMMVGVGNFDDALFAIQQGAGGIFIGSGTDPQILTTPGRDIAELR
RIAGRPLSVAIDFEGGRVLRHRGILGDFPSPQVMAQTMTPEQVRGMAYDMGRSLFAHGIN
VNFAPVVDIEAGLEVVGDRAFSPDPLIDATYATAFAQGMSDAGVRPVLKHFPGHGRASGD
SHTAQVHTPPLAELEKLDLIPYGRVPVAGAGVMVGHMIVPGLGAPETPSTINPAAYQLLR
SGSYPGGQPFSGVIYTDDLTMGAVTSLMPTVQAVPAALAAGADQALWVSTAGLVEAIDAT
VAAVLEGRYPVEQFQASVARVAG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggataacctacgccgcgttttcacacccgcctcgctgattcttggcactgttgttgcc
gctagcatgctgagctcctgctcgcaggactcctcccaacaggctgcgccaagcactcct
tcatcaactcctactgcgtcgcagtctgaacagctctcgtcggcgtcgtcaacgccgcag
gctgttgctttagacccagtgcagctgcgcaaagatgctgccagcttgatgatggtgggc
gtgggtaatttcgacgatgctctctttgccatccagcaaggtgccggcggaatttttatc
ggctcgggtacagatccccagatcttgaccaccccaggccgcgacattgcggagctgcgt
cgaatagcggggcgcccgctgtctgtagccatcgactttgagggtggtcgcgtgttgcgt
caccgcgggatccttggcgatttcccatccccgcaggtgatggcgcaaaccatgacccca
gagcaggtgcgcggaatggcttatgacatgggtcgttccttgttcgcacatggcattaat
gtgaactttgcgccggtagtcgatattgaagccggccttgaagtagtaggcgatcgcgcg
tttagcccagatccgcttatcgacgccacctacgccaccgcattcgcccaaggaatgtct
gatgctggggtgcgtcccgtactcaagcacttcccagggcatggccgcgccagcggcgac
tcgcacaccgcacaagtacacaccccaccattggctgagctagaaaagctcgatctgatc
ccttatggccgagtgccggttgctggtgcgggcgtgatggtaggacacatgatcgtgccg
gggctgggtgctccagaaactccgtcgacgatcaatccagctgcgtaccagttgcttcgt
tccggttcatatcccggtggtcaaccttttagtggcgtgatttacaccgatgatttgact
atgggtgcggttacatcattaatgcccaccgtgcaggcggtaccagcagctctagcagcg
ggtgctgatcaggcactgtgggtaagtacggccggtcttgtggaggctattgatgccact
gtggctgcagtcttggaggggcgttaccccgtcgaacagttccaggcttcagttgcgcga
gtcgcaggctaa

DBGET integrated database retrieval system