KEGG   Corynebacterium diphtheriae C7: CDC7B_2317Help
Entry
CDC7B_2317        CDS       T01699                                 

Definition
(GenBank) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00010  Glycolysis / Gluconeogenesis
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
cds01120  Microbial metabolism in diverse environments
cds01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDC7B_2317
Enzymes [BR:cds01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CDC7B_2317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEX68502
Position
complement(2461028..2461810)
Genome map
AA seq 260 aa AA seqDB search
MSDQIADARLVPLGAILTRMSTIVDMPETRGHLISAITTASDPGEILYLSSRADFSEGGS
IRGGVPIIAPWFAKNLGHDELQHGWARRVEWETIPTNGGIDARTSHDDWDLRLGTQVLPH
GFAMMLKARNASPLRRDFQSAFHPYFRVADVRTTTVTVGDQEFRFDGTAVDQAVPLPEWT
PLVIKDSQRTITVTYQGADHAVVWNPGSELAAQMTDVGEGEWTEFVCVEPALLGDHAQGI
SVPPWDWVEIGMTVKVTPAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatcaaattgcagacgcgcggctcgtgccgttgggggctatccttacaagaatg
agcaccattgtagatatgcctgagactcgcggacatttgatatctgcgattactaccgcc
agcgatcctggcgaaattctttacttatccagtcgcgcggatttttccgagggtggttcg
atccgtggcggtgtcccgatcatcgcaccgtggtttgctaagaacttgggacacgatgag
ttgcagcatggttgggcgcgccgagtggagtgggagacgatccctaccaatggcggtatc
gacgcccgcacgagccacgatgattgggatctgcgccttggcacgcaggtacttcctcat
ggttttgccatgatgttgaaggcccgcaacgcttccccactgcgtcgcgatttccaatcc
gcgttccacccgtatttccgcgttgctgacgtgcgcaccaccaccgtaacggtgggcgat
caggagtttcgtttcgacggcaccgccgtcgaccaagcggttcctctgccagagtggacg
ccgctggttatcaaggattcccagcgcactattactgtcacctaccaaggtgccgatcat
gctgtggtgtggaatcctggcagcgagcttgccgcacagatgacagatgtgggcgaaggt
gaatggaccgagtttgtttgtgtagaaccagcattgttgggtgaccacgcccaaggtatt
tctgttcccccttgggattgggtagagatcggcatgaccgtgaaagtcacaccggctcag
taa

DBGET integrated database retrieval system