KEGG   Corynebacterium diphtheriae C7: CDC7B_2323Help
Entry
CDC7B_2323        CDS       T01699                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDC7B_2323 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDC7B_2323 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDC7B_2323 (trpB1)
Enzymes [BR:cds01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDC7B_2323 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2467284..2468615
Genome map
AA seq 443 aa AA seqDB search
MTDSTLRKTLISAYFGNYGGQFVPDALLPVLDELEQAYVDVLNDPEFSRELARLQKHYLG
RPTPITECANLPLAGKGKGKARIFLKREDLVHGGAHKGNQVLAQALIARRLGKTRLIAET
GAGQHGTATAMVAALMGMDCTIYMGAKDVARQQPNVYRMRLMGATVVPVTNEHGDSMSDA
IDVALMDWVENLDTTHYLIGSAVGPHPFPTLVKEFQAVISRESREQMLELTGKLPDAVIA
AVGGGSNAIGAFADYLTDKPGNESVRLIGVEPAGEGLDSGKHGAPLQRGKVGVQHGFKSF
ILADEQGNPLHSYSVSAGLDYPGVGPEHAHLMESGRAQYYGITDAEALQAFRMLSRYEGI
IPALESSHALAYALKMAENAEETDTPINIVVNLSGRGDKDVDYVRNILGDLATEDPATSP
VTDPHVAETLATMIAESNAREGV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaccctccgtaagacgttaatcagcgcctactttggtaactacggcgga
cagtttgttcccgatgcgctcctgccggttctcgacgaactagagcaggcctatgtggat
gtactcaacgacccagagttttcgcgggaacttgctcggctacaaaagcactaccttggt
cgtcccactcctattaccgaatgcgctaacctccccctagcgggtaaggggaagggtaag
gcgcggatcttcctcaaacgcgaggatctagttcacggtggcgcgcataagggcaatcag
gtgcttgcccaggcgttgattgctcgcagattgggtaaaactcgtttgatcgcagaaacc
ggtgctggtcagcacggtaccgccactgcgatggtggcggctttgatgggaatggactgc
accatttatatgggtgctaaagatgtggcccgccagcagcccaatgtgtatcgcatgcgg
ctcatgggggctacggtggtgccagtaaccaacgagcatggtgattccatgtcggatgct
atcgacgtagcgcttatggactgggtggaaaacttggataccacgcactatctgattggt
tctgcggtcggcccacatccgttccctacgctggtcaaggagtttcaggcggttatttcg
cgggaatctcgcgaacagatgctggagctaacaggcaagcttccggacgcagtaattgct
gccgtgggcggtggttcgaatgctattggtgcgtttgctgattatctcacggataagcca
ggtaatgagtccgtacgcttgattggtgtggagccagcaggcgaaggtcttgattccggt
aagcatggtgcgccgctgcagcgtggcaaggttggtgtgcaacacggcttcaagtcgttc
atcttggctgatgagcagggcaatccgctgcattcttattccgtatcggctggtcttgat
tatccaggcgtgggtccagaacacgcccacctcatggaatctggtcgtgcgcaatattat
ggaatcaccgatgccgaggcgcttcaagcattccggatgctgagccgctacgagggtatc
attccagctttggagtctagccacgctctagcatatgcgttaaagatggcagaaaacgcc
gaagaaaccgatactcccattaacattgtggtcaatctttcgggtcgtggcgataaagat
gtggactatgttcgcaatatcttgggcgacctcgctaccgaggatccagcaacctcacca
gtcacggatcctcatgtcgccgaaaccctcgccacaatgatcgctgagtccaatgcacga
gaaggagtctaa

DBGET integrated database retrieval system