KEGG   Corynebacterium diphtheriae C7: CDC7B_2323Help
Entry
CDC7B_2323        CDS       T01699                                 

Gene name
trpB1
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDC7B_2323 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDC7B_2323 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDC7B_2323 (trpB1)
Enzymes [BR:cds01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDC7B_2323 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2467284..2468615
Genome map
AA seq 443 aa AA seqDB search
MTDSTLRKTLISAYFGNYGGQFVPDALLPVLDELEQAYVDVLNDPEFSRELARLQKHYLG
RPTPITECANLPLAGKGKGKARIFLKREDLVHGGAHKGNQVLAQALIARRLGKTRLIAET
GAGQHGTATAMVAALMGMDCTIYMGAKDVARQQPNVYRMRLMGATVVPVTNEHGDSMSDA
IDVALMDWVENLDTTHYLIGSAVGPHPFPTLVKEFQAVISRESREQMLELTGKLPDAVIA
AVGGGSNAIGAFADYLTDKPGNESVRLIGVEPAGEGLDSGKHGAPLQRGKVGVQHGFKSF
ILADEQGNPLHSYSVSAGLDYPGVGPEHAHLMESGRAQYYGITDAEALQAFRMLSRYEGI
IPALESSHALAYALKMAENAEETDTPINIVVNLSGRGDKDVDYVRNILGDLATEDPATSP
VTDPHVAETLATMIAESNAREGV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaccctccgtaagacgttaatcagcgcctactttggtaactacggcgga
cagtttgttcccgatgcgctcctgccggttctcgacgaactagagcaggcctatgtggat
gtactcaacgacccagagttttcgcgggaacttgctcggctacaaaagcactaccttggt
cgtcccactcctattaccgaatgcgctaacctccccctagcgggtaaggggaagggtaag
gcgcggatcttcctcaaacgcgaggatctagttcacggtggcgcgcataagggcaatcag
gtgcttgcccaggcgttgattgctcgcagattgggtaaaactcgtttgatcgcagaaacc
ggtgctggtcagcacggtaccgccactgcgatggtggcggctttgatgggaatggactgc
accatttatatgggtgctaaagatgtggcccgccagcagcccaatgtgtatcgcatgcgg
ctcatgggggctacggtggtgccagtaaccaacgagcatggtgattccatgtcggatgct
atcgacgtagcgcttatggactgggtggaaaacttggataccacgcactatctgattggt
tctgcggtcggcccacatccgttccctacgctggtcaaggagtttcaggcggttatttcg
cgggaatctcgcgaacagatgctggagctaacaggcaagcttccggacgcagtaattgct
gccgtgggcggtggttcgaatgctattggtgcgtttgctgattatctcacggataagcca
ggtaatgagtccgtacgcttgattggtgtggagccagcaggcgaaggtcttgattccggt
aagcatggtgcgccgctgcagcgtggcaaggttggtgtgcaacacggcttcaagtcgttc
atcttggctgatgagcagggcaatccgctgcattcttattccgtatcggctggtcttgat
tatccaggcgtgggtccagaacacgcccacctcatggaatctggtcgtgcgcaatattat
ggaatcaccgatgccgaggcgcttcaagcattccggatgctgagccgctacgagggtatc
attccagctttggagtctagccacgctctagcatatgcgttaaagatggcagaaaacgcc
gaagaaaccgatactcccattaacattgtggtcaatctttcgggtcgtggcgataaagat
gtggactatgttcgcaatatcttgggcgacctcgctaccgaggatccagcaacctcacca
gtcacggatcctcatgtcgccgaaaccctcgccacaatgatcgctgagtccaatgcacga
gaaggagtctaa

DBGET integrated database retrieval system