KEGG   Corynebacterium diphtheriae C7: CDC7B_2328Help
Entry
CDC7B_2328        CDS       T01699                                 

Gene name
trpC1
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
cds01130  Biosynthesis of antibiotics
cds01230  Biosynthesis of amino acids
Module
cds_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cds00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDC7B_2328 (trpC1)
Enzymes [BR:cds01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CDC7B_2328 (trpC1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CDC7B_2328 (trpC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEX68513
Position
2471846..2473303
Genome map
AA seq 485 aa AA seqDB search
MQSDSSTSPMPTVLESIVSGRRSHLPEIQARISHVDPARLPRSTRSLFHALGGRSDGGPA
LRGSARFIMECKSSSPSLGMIREDYRPGDIARVYSRYAAGISVLCEPDRFGGDYNHLATV
AAATHLPVLCKDFIIHPVQVHAARYFGADAILLMLSVLDDATYTELSQEAARLGLDVLTE
VINEVEVERAIRLGATIFGINHRNLHDLSIDLNRSARLAPLIPDSAVIVSESGIRDNETV
RQLSGHSSAFLVGSQLTSQPDVDRAARELVYGHNKVCGLQSPSEAQAARASGAIYGGLIF
EESSPRNVSRETSQKIMAAEPDLTYIAVSRRTTGWAEIIGDNIAVAQIHSPYQGSIAAEK
ELINHVRGEVGDKVKIWRAVSMTHADGSLVAEALAPEVDRLVLDTGNGGTGSTFDWARIP
EAIKGKALLAGGIGPDNITEALAVGCAGLDLNSGLEYPAEAGKWATHKDAAAIHSTFTQI
RGFHY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcagagtgattcgtcgacaagccccatgcccaccgtcctagaatccatcgtttcgggg
cgacgttcccacctgcccgaaatccaggcgcggatttctcatgtggacccggcgcgacta
ccgcgttccacccgctccttgttccacgcattgggtggccgtagcgatggcggtccggcg
ttgcgggggagtgcgcgctttatcatggagtgtaagtcctcttcgccatcgcttggcatg
attcgtgaggattatcgccctggcgacatcgcgcgggtgtattcacgttatgcggccggc
atttcggtgttgtgcgagccggatcgttttggtggcgactacaaccatctggccacggtg
gcggctgctacgcatcttccggtgttgtgcaaggattttattatccaccctgtgcaggtt
cacgcggcccgttattttggggcggacgcaattttgctcatgttgagtgtgcttgacgac
gccacctacaccgagctcagccaggaagcagcacgcttggggttggatgttctcaccgag
gttatcaacgaggttgaggtggaacgtgccattcggttgggggctacaatctttggcatt
aatcatcgcaatctgcatgacttgagcattgatttgaatcgctcagcacgtcttgcgcca
ctgattcccgatagcgcagtgattgtctccgagtctggcattcgggacaacgagacggtt
cgccaactcagcgggcattccagtgcgttcctcgtaggctcgcagcttacttctcagcca
gatgtggaccgcgcggcccgtgagcttgtgtacggccacaataaggtgtgcggtttgcag
tcgccaagcgaggcgcaagcagcgcgcgcatcgggtgcaatctatggcggattgatcttc
gaggagtctagtccgcgtaatgtttcacgtgaaacatcgcaaaaaatcatggctgccgaa
cctgacctcacctatatcgccgtctcacgacgcaccaccggatgggccgaaatcataggt
gacaacatcgccgttgcccagatccacagtccttaccagggttccatcgccgccgaaaaa
gaactcattaaccatgtgcgcggcgaggtaggagacaaggtaaaaatctggcgcgcagtc
tccatgacgcatgccgacggctcccttgtcgccgaagcactcgcacccgaggtagacaga
ctcgtcctcgacaccggcaatggcggaacgggtagcaccttcgattgggcacgcatccca
gaagccataaaaggcaaggctcttctcgccggcggcattggaccagacaatatcaccgag
gcgctcgccgttggctgcgcaggactcgatctcaactccgggttggaatatccagccgaa
gcggggaagtgggcaacacacaaagacgctgctgcaatccactccactttcacccaaata
cgtgggtttcattactaa

DBGET integrated database retrieval system