KEGG   Corynebacterium diphtheriae HC01: CDHC01_0216Help
Entry
CDHC01_0216       CDS       T01693                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cdt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
193930..194586
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDEFSRLPGVGPKSAQRIAFHLLHVEPADITRLQDALGAIRDGVTFCRICC
NISREEVCRICADSSRDRSTICVVEEPKDIQVIERTGEYTGRYHVLGGSLDPLANIGPRE
LNISQLLQRIGGVLPDRELADSTPETPLYDASPEVREVILATDPNTEGEATASYLARLLR
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggacctctccaagacctgattgacgagttttctcggctccctggtgtgggg
ccgaagtcggctcagcgcattgctttccacctgctccatgtggaaccagcagacattacg
cgtctgcaagatgcgctgggtgctattcgtgacggtgttactttctgccgcatttgctgc
aatatctctcgcgaagaggtctgccgcatttgtgcggactcttcacgcgaccgcagcacc
atctgtgtggtggaagaacccaaagacattcaggttattgaacgaaccggcgagtacaca
ggtcgctaccatgtgctcggcggctcgcttgacccccttgccaacattggcccccgtgag
ctcaacatttcgcaattattgcagcgtatcggcggcgtgttgccagaccgcgaacttgcg
gactccacccccgagacaccgctttacgacgcctccccagaagtgcgcgaggttatcctc
gccaccgaccccaacaccgaaggcgaagccacagcctcctacctagcgcggctgctgcgc
gacttcccagaccttgtggtgtcacgccttgcctctggcatgccactcggcggcgacttg
gagttcgttgacgaacttacactgtcgcgtgcgctgagcggcagactgacgctgtag

DBGET integrated database retrieval system