KEGG   Corynebacterium diphtheriae HC01: CDHC01_0343Help
Entry
CDHC01_0343       CDS       T01693                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDHC01_0343 (hemB)
Enzymes [BR:cdt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CDHC01_0343 (hemB)
Exosome [BR:cdt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDHC01_0343 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
327059..328051
Genome map
AA seq 330 aa AA seqDB search
MNLDLIRRPRRLRSTPVMREFVAETTLRPADLILPMFIADGIDKPREIESMPGVCQHTME
SLIEAVREAISVGIRCVDLFGVPLDSDKDATGSQAWDPEGILNRGVRALRQEFGDQVLIM
ADTCLDEFTDHGHCGILTTDRFGTTIVDNDPTVELYQKMAVAQAEAGAHIVSPSGMMDGQ
ILAIREALDAAGFHDVAIMAYSAKYASAFYGPFRDAVGSSLQGDRRAYQQDPANLRESIL
EVDLDIEEGADFVMVKPAMPYLDVLAEVASTSSVPVAAYQVSGEYAMLHAAAANGWLDLD
RVMMESLISIKRAGADQILTYFAVEAARKL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatctagatcttattcgtcgtcctcgtcggttgcgttcgactccggtgatgcgtgaa
ttcgttgcggaaaccacgctgcgtccggctgatcttattttgccgatgtttattgccgat
ggcattgataagcctcgggagattgagtcgatgccaggtgtgtgccagcacaccatggaa
tcccttatagaggctgtccgtgaggcgatctcggtgggtattcgctgcgtggatcttttc
ggcgtgccactggattccgataaggatgccactggttcacaagcgtgggatcccgagggc
attttgaaccgcggtgtgcgtgcgcttcgtcaggagttcggcgatcaggtcctcatcatg
gcggatacctgccttgacgagttcaccgatcatgggcactgtggcattttgaccacggat
cgctttggcaccaccatcgtggataacgatccaacggttgagttgtatcagaagatggcg
gttgctcaggctgaagcgggtgctcatattgtgagcccgtcgggcatgatggacggccag
attttagctatccgtgaggctctcgacgccgcagggttccacgatgttgcgatcatggcg
tattccgctaagtatgcgtcggcattttatggtcctttccgtgacgcagtgggctcctct
ttgcagggtgatcgccgtgcctaccagcaggatcctgctaatctccgtgagtcgatcctc
gaagtcgatctggacatcgaggaaggcgcggattttgttatggtcaaacctgctatgccg
tacttggatgtgcttgctgaggtagcgtctacgtcgtcggttccggtggcggcttaccag
gtttctggcgagtatgcgatgttgcatgcggctgctgcgaacggctggttggatctggat
cgggtgatgatggagtctctgatttctattaaacgtgccggtgcggatcaaatcctgaca
tactttgctgtagaagcagcacgaaaactttaa

DBGET integrated database retrieval system