KEGG   Corynebacterium diphtheriae HC01: CDHC01_0737Help
Entry
CDHC01_0737       CDS       T01693                                 

Definition
putative folate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDHC01_0737
   00670 One carbon pool by folate
    CDHC01_0737
Enzymes [BR:cdt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CDHC01_0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(746170..746673)
Genome map
AA seq 167 aa AA seqDB search
MLRAIWAQSTDGVIGDGNDMPWHVPEDLAYFKATTLGEPVIMGRTTWTTIPERFRPLPGR
RNFVLSSRAPGAWSTGAEVVTAIPELDCDAWIMGGGAVYTSTLPLVDEVVITLIDVTLAP
VLGDAAVYAPALDDSFEVVEESPWQQSASGTVLGTPARYKFQRLRRR
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgcgatttgggctcagtccactgatggggtgattggcgatggcaacgacatg
ccctggcatgttcccgaagacctcgcctatttcaaggccaccactttgggcgaacctgtg
attatgggtcgcaccacgtggactacgatcccagaacgcttccgcccgctgccagggcgt
cgtaactttgtgctctcctcccgagcacccggcgcgtggagcacgggtgccgaggtcgtc
actgcaatccccgagctcgactgcgatgcatggatcatgggcggcggcgccgtctacaca
agcacacttccgctggtagacgaggtagtgatcacgcttatcgacgtcaccctcgctccc
gtactcggcgacgcagcagtatatgcaccagccctcgacgatagctttgaggttgttgag
gaatccccatggcagcaatctgcttccgggaccgtgctgggtactccggcccgctataag
ttccaaaggttgcgcaggcgttaa

DBGET integrated database retrieval system