KEGG   Corynebacterium diphtheriae HC01: CDHC01_0775Help
Entry
CDHC01_0775       CDS       T01693                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CDHC01_0775 (galU)
   00052 Galactose metabolism
    CDHC01_0775 (galU)
   00500 Starch and sucrose metabolism
    CDHC01_0775 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CDHC01_0775 (galU)
Enzymes [BR:cdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CDHC01_0775 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
781705..782625
Genome map
AA seq 306 aa AA seqDB search
MTSPKSGNSCAVRTVIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLGATR
LAVITAPKKQEVLDHFNRFPELEATLESRGKKDQLAKVVRAAELIQPVSVVQETPLGLGH
AVGLAESVLDDDEDVVAVMLPDDLVLPMGVVEKMVEVRRQLGGSVLCAFDVPREDVYNYG
VFDIEECDYDGPYQVKSVKGMVEKPAVEDAPSTFVATGRYLLDRAIFDALRRITPGAGGE
LQLTDAIALLINEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLSDPTYGPHLKKVLRTI
LEEHGA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacccaagagtggtaattcgtgtgccgtcagaaccgtgatcgtcccagctgct
ggtttgggtacacggtttctccctgccacaaagaccgtccctaaggagctccttcctgtc
gtcgatacgccaggtatcgagctgattgctgaggaggccgcgcagttgggggcaacgcgt
ttggctgtgattacggcgccgaaaaagcaggaagtgttggatcacttcaacaggttccca
gagctggaagcaacgttggaaagtcgtggcaagaaggatcagctggcaaaggttgtgcgt
gctgctgaactgattcagccggtttctgtggttcaagagactccgcttggtctggggcat
gcagtggggttggcggaaagcgtgttggatgacgatgaagacgtcgtagctgtcatgctt
ccggatgacttggtgctgcccatgggcgttgtggaaaagatggtggaggtgcgtcgccag
ctgggaggctctgtgctgtgcgctttcgatgttcctcgtgaagatgtgtataactacggc
gtctttgatattgaggagtgcgattacgacggcccttaccaagtcaagagtgtgaaaggc
atggtggaaaagccagccgtagaagacgcaccttcgacgtttgttgcaacaggtcgttat
cttttggatcgtgcgatttttgatgcgcttcgccgtatcacccctggtgcgggcggtgag
ctgcagcttactgatgctattgcgttgcttattaatgaggggcatccagtccacatcttg
gttcacgatggaaagcgccatgatttgggaaatcctggtggttatatcccagcggtggtg
gattttggtttgtcggatccgacgtatggcccacatttgaagaaggtcctgcgtaccatt
ttggaagagcacggcgcttaa

DBGET integrated database retrieval system