KEGG   Corynebacterium diphtheriae HC01: CDHC01_0890Help
Entry
CDHC01_0890       CDS       T01693                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
cdt00300  Lysine biosynthesis
cdt01100  Metabolic pathways
cdt01120  Microbial metabolism in diverse environments
cdt01230  Biosynthesis of amino acids
Module
cdt_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CDHC01_0890 (dapE)
Enzymes [BR:cdt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CDHC01_0890 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEX74141
Position
901437..902534
Genome map
AA seq 365 aa AA seqDB search
MLDLTTNPIDLTRALVDIESPSHYEKNIADAIEQALHAIDNVEVLRHGNTLVARTHRGLG
ERVILAGHIDTVPIADNVPSHMEGDVMFGCGTVDMKSGMAVYLHAFATLANHPALAKDLT
VVCYEGEEVASEYNGLGHVQAAHPDWLSGDLALLGEPSGAVIEAGCQGTIRLRVTAHGVR
AHSARSWLGDNAMHKLAPVITNIAQYHAQEMLVDGCLYHEGLNIVHCESGVATNTIPDEA
WMFVNFRFAPNRSVDEALAHMLEVLDLPEGVTYDIDDAVPGARPGLDRPAAAALLEATGG
KFRAKYGWTDVSRFSEIGVPAVNFGPGDPAYCHKKDEQCPVSMITEVSRTLVHYLTSTNS
QTTGA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatttgactacgaatcccattgacctcacccgcgcacttgttgatatagaaagc
ccctcccattacgaaaagaacatagccgacgccatcgagcaggctcttcatgccatcgac
aatgttgaagtgctacgccacggcaatactcttgttgctcggacccatcgaggactagga
gaaagagtaatcctcgccggccacatcgacaccgtcccaatagccgacaacgttcctagc
cacatggaaggcgacgtaatgttcggctgcggcaccgtcgatatgaaatcgggcatggct
gtctatcttcatgcctttgccaccttggctaaccacccggcgctggcgaaggacttgacc
gtcgtctgttatgagggcgaggaagtcgctagtgaatacaacggactagggcatgtgcag
gcagctcaccccgactggttaagtggcgatctcgccctcctaggcgagccctctggtgct
gtgatcgaggctggatgccaaggaacgattcgtttgcgcgtcaccgcccatggtgtgcgc
gcacactcggcacggtcgtggctaggagacaacgccatgcacaaattagcgccagttatt
acgaatatcgcacagtaccacgcccaagaaatgcttgtcgacggctgcctctaccacgag
ggcctcaacatcgtgcattgcgaatctggggttgccacgaacactatccccgatgaggcc
tggatgtttgttaacttccgtttcgcacctaataggagtgttgacgaagccctagcccac
atgctggaggtgttggatctacccgagggggtgacctatgacatcgacgatgctgttcca
ggggcacgtccgggtttggatcgtccggcagctgccgccctcctagaggcgacaggcgga
aaattccgcgcaaagtacggttggacggatgtgtcgaggttttctgagattggtgttcca
gcggtgaactttggtcctggggatccggcatattgccataaaaaagacgaacaatgccca
gtcagcatgattaccgaagtctctcgcacgctggtgcactatctcacgagtacgaattcc
cagacgacaggagcctga

DBGET integrated database retrieval system