KEGG   Corynebacterium diphtheriae HC01: CDHC01_1236Help
Entry
CDHC01_1236       CDS       T01693                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
cdt00010  Glycolysis / Gluconeogenesis
cdt00051  Fructose and mannose metabolism
cdt00562  Inositol phosphate metabolism
cdt01100  Metabolic pathways
cdt01110  Biosynthesis of secondary metabolites
cdt01120  Microbial metabolism in diverse environments
cdt01130  Biosynthesis of antibiotics
cdt01200  Carbon metabolism
cdt01230  Biosynthesis of amino acids
Module
cdt_M00002  Glycolysis, core module involving three-carbon compounds
cdt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC01_1236 (tpi)
   00051 Fructose and mannose metabolism
    CDHC01_1236 (tpi)
   00562 Inositol phosphate metabolism
    CDHC01_1236 (tpi)
Enzymes [BR:cdt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CDHC01_1236 (tpi)
Exosome [BR:cdt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CDHC01_1236 (tpi)
  Exosomal proteins of bladder cancer cells
   CDHC01_1236 (tpi)
  Exosomal proteins of melanoma cells
   CDHC01_1236 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM BCSC_C
Motif
Other DBs
NCBI-ProteinID: AEX74487
Position
complement(1292527..1293309)
Genome map
AA seq 260 aa AA seqDB search
MARTPLIAGNWKMNLDHLQAVATVQKLAFALPKEYYEKVDVAVTVPFTDLRSVQTLIEGD
KLAITYGAQDVSQHEAGAYTGEISAQMLAKLGCTWVVVGHSERREYHGESSELVAVKAKA
ALNQGISPIVCVGEPLEIREAGTHVEYVVEQTRASLAGLTADDLAKTVIAYEPVWAIGTG
KVASAADAQEVCAAIRNLIIELAGKEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATVVD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtactccacttatcgcaggaaactggaagatgaatcttgatcatcttcaagct
gttgcaactgtgcaaaaacttgcttttgcacttccaaaggaatactacgaaaaagtcgac
gtagctgtcaccgtaccttttactgatcttcgctctgttcaaacacttatcgaaggcgat
aagctcgctataacttatggtgctcaagatgtttcgcagcacgaggctggtgcctacact
ggtgaaatctctgcccagatgcttgccaaactcggatgtacttgggttgttgttgggcac
tcagagcgtcgtgagtaccatggcgaatcttcggagcttgttgcagtcaaagctaaagct
gcgttgaaccaaggaattagccccatcgtttgtgttggagagccccttgaaattcgtgaa
gctggaacacacgtagaatatgtcgtcgaacagactcgcgcatcgttggcgggtcttact
gcagatgatttggcgaagactgttatcgcctacgaacccgtatgggctattggtacgggt
aaagtagcatccgctgccgatgcacaggaagtctgcgcagcaattcgtaacctcatcatt
gagcttgctggtaaagaagtagctgaagggcttcgcattctttatggcggatcagttaaa
gcagaaacagtagccgagatcgtaggtcaaccggatgttgatggcggcttagtgggtggc
gcttctcttgacggtgaagcattcgccaaactagcagctaatgcagcaactgttgtcgac
tag

DBGET integrated database retrieval system