KEGG   Corynebacterium diphtheriae HC01: CDHC01_1348Help
Entry
CDHC01_1348       CDS       T01693                                 

Gene name
ppgK
Definition
polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:cdt01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdt00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cdt00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1410472..1411233
Genome map
AA seq 253 aa AA seqDB search
MIRMENIGFGIDVGGSGIKGARVNLDTGEFVGDRIKILTPKPATPDAVAETIKRILDQAE
WEGPVGITLPSVIHEQRALTAANIDPSWIDVDVNELFARHLGDTEVSVLNDADAAGLAEA
QFGDPIAREGSVILLTFGTGIGSAFLVNGTLFPNTELGHMLVDGEEAEKIASSAAKDRDE
IGYGKWAKRVSKVLNEYERLFWPSAFIVGGGISRKAEKWVPRLTVNTKVVPAQLRNTAGI
VGAAMAASQNLHP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcatggaaaacatcggattcggtatcgacgttggcggctctggtatcaaggga
gcgcgcgtgaatctagacacaggagaatttgtaggagatcgtatcaagattcttactcct
aaacctgcaacccccgatgcagtcgccgaaacaatcaaacgcatcctcgatcaagccgaa
tgggaagggcctgtcggcattactctaccttccgtcattcacgaacaacgagccctcacc
gccgccaatatcgacccatcgtggattgatgtagacgtaaatgagctatttgctcggcac
ttaggcgacaccgaagtttcggttctcaatgacgccgacgctgcgggattggcagaagcc
caatttggcgatcccattgcacgtgaaggaagtgtaatccttctaacctttggtacaggt
ataggttcagcattcttagtcaacggtacgttgtttcccaacactgaactaggccacatg
cttgtagatggcgaagaagcagaaaaaatcgcatcgtctgcagccaaagatcgcgatgaa
attggatacggaaagtgggctaagcgcgtatcgaaggtgctcaacgaatatgagcggctc
ttttggccatcagcttttatcgtcggtggtggcatctcccgtaaagctgaaaagtgggta
cctcgtctcaccgttaacaccaaggttgtcccagcccagctaagaaacaccgctggaatc
gtaggagctgccatggcagcatcccaaaatcttcacccttaa

DBGET integrated database retrieval system