KEGG   Corynebacterium diphtheriae HC01: CDHC01_1435Help
Entry
CDHC01_1435       CDS       T01693                                 

Gene name
chlI2
Definition
magnesium chelatase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDHC01_1435 (chlI2)
Enzymes [BR:cdt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CDHC01_1435 (chlI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1500512..1501597)
Genome map
AA seq 361 aa AA seqDB search
MSTKQSPLFPFSAVVGQDQLRLALILTAISPRIGGVVIRGEKGTAKTTTVRAFAALLGDA
PLVNLPIGATEDRVVGSLDMETVLTTGKAKFRPGLLSQAHGGVLYVDEVNLLADHLVDAL
LDAAATGQVTVERDGISHTAPACFVFVGTMNPEEGELRPQLLDRFGLSVDVAASKDVQIR
AEIMRRRLDFESDPIDFAQRWHALDENTSQAIKSAQERVDSIVLSDTNLARIAHICASFD
VDGMRADLVIARTAIAHAAWRGDSLVTDEDIKVAAELALPHRRRRDPFDEPGLDQDQLDE
VMDEARDQHPEMDDPAEQSAHEDQIENETSDQEDHLDDQETQTPDSDGQEGSASQGAPFR
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaagcagtctccgctttttcctttttctgccgttgtaggccaagatcaactg
cgactcgcgttaattcttacagcgatttcaccacgaattggtggcgtagtaatccgcggt
gaaaagggaaccgcaaaaacgacgacggttcgtgcatttgcagcgttgctaggtgatgcg
ccactggtcaatcttcccatcggagcaacggaagatcgcgttgttggctcgttagacatg
gagactgtgctaacaacaggaaaagctaagtttcgcccaggcttgctctcccaagcgcat
ggtggtgttttgtacgtcgatgaggtcaacttgttggctgatcatctcgttgatgcgctt
cttgatgcggccgcgactgggcaagtgactgttgaacgtgatggtatttcgcatacagct
cctgcttgttttgtgttcgtaggaaccatgaatccagaagaaggggaattgcggcctcag
ctgctcgatcgttttggactttctgtagatgtagcagcatcgaaggatgttcagattcgg
gcagaaattatgcgcagacgactcgattttgaatctgaccccattgactttgcacaacgc
tggcatgcactagacgagaacacgtcgcaagcaatcaagagcgcgcaagaacgtgtcgat
agcattgtgctcagtgatacaaatttggcacgtatcgctcatatttgtgcttcttttgac
gttgatggcatgcgtgctgatctcgttattgctcgtactgctattgcccatgctgcatgg
cgcggtgattcgctggtgactgacgaggacatcaaagtagcagcagaacttgctctgccg
catcgacggcgtagggacccgtttgatgaacccggccttgatcaagaccaacttgatgaa
gttatggatgaagcacgtgaccagcacccagagatggatgatcctgctgaacaatcagca
catgaggatcaaatagaaaacgaaacttctgatcaggaagatcatctagacgatcaagaa
actcagactcctgattccgatggtcaggagggcagcgcttctcaaggcgccccctttcgt
ccctaa

DBGET integrated database retrieval system