KEGG   Corynebacterium diphtheriae HC01: CDHC01_1661Help
Entry
CDHC01_1661       CDS       T01693                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CDHC01_1661 (malQ)
Enzymes [BR:cdt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CDHC01_1661 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1751204..1753372
Genome map
AA seq 722 aa AA seqDB search
MSYSDLLRELAAAHAISSSYSGFGGAHVEVSDDTLVKTLRSLGVCFGNEDEPATDHEPLT
GPMPSEDQIRYALQQRYDAEATRPLPRCVVAVESDPYVFNVHVHDGAPADITITLEDGST
AEVTQVENWTPPREVDGITWGEASFQLPSDLPLGWHTITLTSDTLTSSCFLIVTPARLST
ADKYAEHPVSGVMAQLYSARSKNSWGMGDFNDLGLLAETLAPQADYLLINPLHAAEPMPP
VEDSPYLPTTRRFINPIYIRIEDIPEHLLLDDDLQNDVTELAEEFTALNLTPKKIERNPI
FDAKLQVLHAVFNVEREPAREQDFQDFIATEGQGLRDFASWCAEQELAVLENSAAHAALP
EKESLIQFYMWQQWICDQQLGAAQTRATDAGMSIGIIADLAVGIHPAGADALSLADTLVA
RASVGAPPDSYNHQGQDWSQPPWHPDRLAESGYIPWRDLLRTVLRHAGGVRVDHILGLFR
LFWIPRTQSPQTGTYVNYDHNALVGVLALEAERAGAVVIGEDLGTFEPWVQDFLASRGIM
GTSVLWFESSPEGGPRKQHEYRQLALTSVTTHDLPPTAGYLAGEHIALREELGILTTDVA
TEYAEDLNWQADILNVVRNSGAFDSIVPADFHGVDRADRGSSVELLSALHRFLAGTPSAL
ACTALVDLVADKRAQNQPGTTSDQYPNWCIPLCDESGTPVLIEDLAENPVYQAVTKASTR
LH
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtgagttactcagatttgttacgcgagctggccgctgcccacgcaatctcttcgtcgtac
tccggtttcggtggagcacacgtggaagtttcggatgacacgctggtcaagactctgcga
tccctcggagtttgcttcggaaatgaagacgaacccgccaccgaccacgagcctttgact
gggcctatgcctagcgaggatcaaatccgctacgccctacaacagcgttacgacgccgaa
gcaacccgccccctcccccgatgtgtggttgccgtcgaaagcgatccctatgtgttcaac
gtccatgttcacgacggtgctcccgccgacatcaccatcactttggaagatggttcaacc
gcagaggttacccaggttgaaaactggactccaccccgtgaagttgatggcattacttgg
ggtgaagcttccttccagctgccgtccgatcttccactgggctggcacaccatcaccttg
acctccgacacgctaacgtcaagctgcttcctcatcgtgaccccggcgcgtctatctacc
gccgacaagtatgcagagcaccctgtcagcggtgttatggcgcagctgtactcggctcgc
agcaagaattcttggggcatgggtgacttcaatgacctcggcttgttggctgagacgctt
gctcctcaggctgattatctgttgattaatcctctgcacgctgctgagccgatgccacca
gttgaggattccccatacttgcctactacgcggcgttttatcaacccaatttatatccgc
atcgaagatatccctgaacacttgcttctcgacgatgacctacaaaatgatgtcaccgaa
cttgcggaagagttcacagcacttaatctcacccctaaaaagattgagcgcaatccaatt
tttgatgccaagttgcaagttctgcacgcggtattcaatgtagagcgcgaaccagcacgt
gaacaggacttccaagacttcatcgccaccgaaggccaaggcctacgagacttcgcttca
tggtgcgcagagcaggagctagcagttttggagaactccgcagcacatgccgctcttccg
gaaaaagaatctcttatccagttctacatgtggcagcagtggatttgcgatcaacagctt
ggtgctgctcaaacccgcgcaaccgacgctggaatgagcatcggtatcatcgccgatctc
gccgtgggcattcaccctgcgggtgccgatgcactttcgcttgccgacaccctagtcgcc
cgcgcttctgtgggtgcgccaccagatagctacaaccaccaaggccaagactggtctcag
ccaccatggcacccagaccgcttggctgagtcgggctatatcccttggcgtgacctgctg
cgcacggtgcttcgccacgccggtggtgtccgtgttgaccacattcttggtcttttccgc
ttgttctggattcctcgcacccagtccccacaaacgggtacttacgtcaactacgatcac
aatgcacttgtgggcgtacttgctcttgaggcagagcgtgcaggcgcagtggttatcggt
gaagacctcggtaccttcgagccatgggtccaagacttccttgcgtcccgaggtatcatg
ggtacttcagtgctgtggttcgaaagttccccagaaggtggccctcgcaagcagcacgag
taccgtcagttggcgctgacctcggtaaccacccatgatctgccaccaacagcgggctat
ctggcaggcgagcacattgcgttgcgtgaggaactcggaattttgaccaccgatgtagca
actgagtatgccgaggatttgaactggcaggcagacatcctcaatgtagttcgcaactcg
ggcgcatttgactccatcgtccctgccgatttccacggtgtagatcgtgctgaccgcggc
agctccgtcgaattgctttccgcgcttcaccgcttcttggctggtacaccatcagctctg
gcctgcaccgctttggtggatcttgtcgccgataagcgtgcgcagaaccagccgggtact
acttcggatcagtacccgaactggtgtattccgctatgcgacgagtccggcactccagtc
cttatcgaggacttggccgaaaaccccgtctatcaagcggtaacaaaggcgtcgactcgc
ctacattag

DBGET integrated database retrieval system