KEGG   Corynebacterium diphtheriae HC01: CDHC01_1839Help
Entry
CDHC01_1839       CDS       T01693                                 

Gene name
gpx
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
cdt00480  Glutathione metabolism
cdt00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CDHC01_1839 (gpx)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CDHC01_1839 (gpx)
Enzymes [BR:cdt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CDHC01_1839 (gpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AEX75083
Position
complement(1946703..1947173)
Genome map
AA seq 156 aa AA seqDB search
MSIFDTEVTLINGEKASMDQWAGHCLLIVNTASECGYTPQLETLEELYEDYAMRGFFVIG
VPCNQFGEEEPGKDAQVARRYEEKFGVRFPLLAKSDVNGPNTIELYKKLKGDGPDIEWNF
EKFIVAPSGEVVGRFAPSLNPDDMKIINVLEEYLPI
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttgataccgaggtcacgctgatcaacggcgagaaagcctcaatggatcag
tgggctggtcattgcctgttgattgtgaatacggcatcagagtgcggctataccccgcag
ctggagacgctggaagagctttatgaggattatgcgatgcgtggtttcttcgtaatcggt
gttccgtgtaaccagttcggggaggaagaacctggcaaggatgctcaggtggcgcgtcga
tacgaagaaaagtttggggtgcgcttcccgctgttggctaagtcggacgtcaatggcccc
aacactattgagctgtataagaagctcaagggtgatggtccagatattgagtggaacttt
gaaaagtttatcgtagcgcccagcggtgaggtggtaggccgctttgcgccctcgcttaat
cctgacgatatgaagatcattaacgtcttagaagagtatcttcctatctaa

DBGET integrated database retrieval system