KEGG   Corynebacterium diphtheriae HC01: CDHC01_1893Help
Entry
CDHC01_1893       CDS       T01693                                 

Gene name
folK
Definition
putative 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cdt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2003890..2004369)
Genome map
AA seq 159 aa AA seqDB search
MRAVLSIGSNMDDRYALLRTVVEEFAGEIVAASSIYSTPPWGVEDQDEFLNAVVIVDVDS
SPPELLRRGQRLEEAACRRRLRHWGPRTLDVDVVTIYNDDGTQMRSTDPELTLPHPYAHE
RAFVLVPWAEADPEAELLGQKVAQRAAALGETFPVVGSL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagtgctttctattggttcgaatatggatgaccgctatgccttgctgcgaacg
gttgtcgaagaattcgcgggagagatcgtggcagcatcctcgatctactccacgcccccg
tggggagtagaggaccaagacgagttcctcaacgcggtagtcattgtggacgtcgatagt
tcaccccctgagctgctaagacgtggccagcgcctagaagaagccgcgtgtcgacgtcgc
ctgcggcactggggtccgcgcaccctcgacgtcgatgtcgtaaccatctacaacgacgac
ggcacgcagatgcgatccaccgaccccgagctgaccctgccgcacccctacgcccacgag
cgagcctttgtgcttgtgccttgggcagaagcagaccccgaagctgaattgctaggccag
aaagtagcgcagcgcgccgcagcactgggcgaaacatttccggtggtgggaagcctatga

DBGET integrated database retrieval system