KEGG   Corynebacterium diphtheriae HC01: CDHC01_1895Help
Entry
CDHC01_1895       CDS       T01693                                 

Definition
putative dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDHC01_1895
Enzymes [BR:cdt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CDHC01_1895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2004750..2005586)
Genome map
AA seq 278 aa AA seqDB search
MSAKDLIIPERTAVMGIVNVTEDSFSDGGRWLDIDAAIDHARDLVAAGADIIDVGGESTR
PGATRVDPDVERSRVIPVIRALSEEGIATSIDTMRASVAAAAANAGVKLINDVSGGLADR
AMYSVMADTQLPVCLMHWKTVRFGDAAGSADHGGDVVADVHQTLDKLVTSALNAGVKEDN
ITIDPGLGFAKTQEDNWALLRALPEFIAGPYPVLVGASRKRFLMAVRAARGLQSGPVDAD
PATAAVTAIAAHMGAWCVRVHEVAVSRDAVDVAALWNA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgaaagacctcatcattcccgagcgaacagccgtcatgggcattgtgaacgtc
actgaagattcattttccgacggtggccgctggctcgacattgatgccgcaatcgaccac
gcccgcgacctcgtcgcagcaggcgcagacatcatcgacgtcggtggcgaatccacccgc
ccaggtgccactcgcgtcgaccccgacgtggaacgcagccgcgtgatccccgtcatccgg
gcgctgtccgaagaaggcatcgccacctccatcgacaccatgcgcgccagcgttgcagcc
gcagcagccaacgccggcgtaaaactcatcaacgatgtttccggtgggctcgccgaccgc
gccatgtactccgtcatggccgacacccaactaccggtctgcctcatgcactggaagacc
gttcgcttcggggacgcagcaggaagcgccgaccacggcggcgacgttgtagcggacgta
caccagaccctagataagctggtcacctctgcactcaacgccggtgtcaaagaagacaac
atcaccatcgacccaggtctcggctttgccaaaacacaagaagataactgggcactctta
cgcgccctaccggaatttatcgcaggcccataccccgtgctcgtaggagcatcacgcaaa
cgcttcctgatggcagtccgcgccgcccgaggcctgcaatcagggccagtcgacgccgac
cccgccaccgcagcggtgacagcgatcgccgcacacatgggagcatggtgcgtgcgcgtc
cacgaagtagcagtttcccgagacgcggtcgacgttgcggccctgtggaatgcgtga

DBGET integrated database retrieval system